DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ibsp and CG1647

DIOPT Version :9

Sequence 1:NP_036719.2 Gene:Ibsp / 24477 RGDID:2855 Length:319 Species:Rattus norvegicus
Sequence 2:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster


Alignment Length:317 Identity:67/317 - (21%)
Similarity:105/317 - (33%) Gaps:104/317 - (32%)


- Green bases have known domain annotations that are detailed below.


  Rat    59 PVQGGSDSSEENGDGDSSEEEGEEEETSNEEENNEDSEGNEDQEAEA-----------ENATLSG 112
            |.:|.::|..|....:.....|::.:.:|:|......|...|:.:.|           :.....|
  Fly   463 PPRGQAESDPEPERNEEHPSFGDDIQAANDECQECQPETESDKISVAACDDIPSVSVKQEPEYDG 527

  Rat   113 VTASYGV---------ETTADAGKLELAALQLPKKAGDAEGKAPKMKESDEEEEEEEEEENENE- 167
            .....||         :.|.:.|||..:.:....:||.|.|::.|.|:..:.:|.|:|..||.| 
  Fly   528 YEKQTGVKQEPLKLKLKITKNHGKLNSSLIDDLDEAGQAFGRSSKKKKKRKHKEREKEASNETEN 592

  Rat   168 -----------------------------------EAEVDENE----------QVVNGTSTNSTE 187
                                               |:.::|:|          |.......|..|
  Fly   593 CRTESQNQPAIKIKQEPVDYAPEATVMTTIPMTQFESSLNESERSEEVDEAMIQSQEDVKPNRME 657

  Rat   188 VDG----GNGPSGGDNGEE------AEEA---------SVTEAGAEGTTAGARELTSYGTTTAVL 233
            :|.    .|..||.|..||      ||||         ...::.|..:|.||...|.....|..|
  Fly   658 LDRMMQISNVTSGVDMAEEAMALERAEEACPEDSLHKVKSVKSTARKSTGGAERKTYSPPRTNTL 722

  Rat   234 ------LNG---FQQTTPPPE----AYGTTSPPARKSSTVEYG------EEYEQIGN 271
                  ::|   |...:..||    .||...|..::.:|.|..      ||.|.||:
  Fly   723 PQIVAVVSGESAFNMISIKPEPRNLGYGDEEPEDQRETTEEINHNDMMEEEKEYIGS 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IbspNP_036719.2 BSP_II 17..316 CDD:283165 67/317 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..116 11/67 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..224 33/153 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..263 8/29 (28%)
Cell attachment site 288..290
CG1647NP_651636.1 zf-AD 19..99 CDD:285071
C2H2 Zn finger 203..224 CDD:275368
C2H2 Zn finger 233..253 CDD:275368
C2H2 Zn finger 262..282 CDD:275368
C2H2 Zn finger 297..314 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.