DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ibsp and Cp190

DIOPT Version :9

Sequence 1:NP_036719.2 Gene:Ibsp / 24477 RGDID:2855 Length:319 Species:Rattus norvegicus
Sequence 2:NP_524359.2 Gene:Cp190 / 41848 FlyBaseID:FBgn0000283 Length:1096 Species:Drosophila melanogaster


Alignment Length:296 Identity:61/296 - (20%)
Similarity:112/296 - (37%) Gaps:95/296 - (32%)


- Green bases have known domain annotations that are detailed below.


  Rat    26 IKAEDSEE-----NGVFKYRPRYFLYKHAYFYPPLKRFPVQGGSDSSEENGDGDSSEEE--GEEE 83
            :..:|:::     |.||:...:  ||:|...|          ..:.:.|:|..|.::||  |.::
  Fly   560 VHTDDNKQQCIYCNKVFEQELQ--LYRHMKSY----------HKEQALEDGIIDETDEEFLGSQD 612

  Rat    84 ETSNEEENNEDSEGNEDQEAEAENATLSGVTASYGVETTADAGKLE-LAALQLPKKAGDAEGKAP 147
            |       .|::||:|:||.|                   ..||:. |:.:.||..:      |.
  Fly   613 E-------EEEAEGDEEQEPE-------------------QTGKVRILSDISLPATS------AI 645

  Rat   148 KMKESDEEEEEEEEEENENEEAE---VDENEQVVNGTSTNSTEV------------DGG-----N 192
            .::::.:|:.:||:.|...:|.:   .|.||  |..|.....|:            .||     :
  Fly   646 TVQQAQQEQLQEEDVEQVQQEVKFVGADGNE--VELTDEQRKEILSQLNQQQAGATAGGVVMVLS 708

  Rat   193 GPSGGDNGEEAEEASVTEAGAEGTTAGARELTSYGTTTAVLLNGFQQTTPPPEAYGTTSPPARKS 257
            .|......:|.:|.|:  ||.|.....::..:..|...:|                   ..|:|:
  Fly   709 EPEAEHVKQETDEKSL--AGTEEEYDDSQIYSELGAADSV-------------------ESAKKN 752

  Rat   258 STVEYGEEYEQIGNEYNTAYETYDENNGEPRGDTYR 293
            ...|..|..:.:....|...|:.:::|.||:.|..|
  Fly   753 IADESKESIDNLEWAENLIAESEEQSNKEPKSDKPR 788

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IbspNP_036719.2 BSP_II 17..316 CDD:283165 61/296 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..116 14/58 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..224 23/108 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..263 3/25 (12%)
Cell attachment site 288..290 0/1 (0%)
Cp190NP_524359.2 BTB 20..122 CDD:279045
BTB 31..127 CDD:197585
C2H2 Zn finger 540..568 CDD:275371 1/7 (14%)
C2H2 Zn finger 569..586 CDD:275371 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.