DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxc8 and zen2

DIOPT Version :9

Sequence 1:NP_001170797.2 Gene:Hoxc8 / 24460 RGDID:2821 Length:242 Species:Rattus norvegicus
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:118 Identity:49/118 - (41%)
Similarity:66/118 - (55%) Gaps:12/118 - (10%)


- Green bases have known domain annotations that are detailed below.


  Rat   130 NQNSSPSLMFPWMR------PHAPGRRS-----GRQTYSRYQTLELEKEFLFNPYLTRKRRIEVS 183
            |.:.|..:|:|.:.      |.|..|.|     .|..:|..|.:|||:||..|.||.|.||||:|
  Fly    13 NYSVSDLMMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEIS 77

  Rat   184 HALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEE-KVEEEGNEEEEKEEE 235
            ..|.||||||||||||||||.||..|:....||.... .:..:.:|:.:|:::
  Fly    78 QRLALTERQVKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSEDLQKDDQ 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxc8NP_001170797.2 Homeobox 153..206 CDD:395001 34/52 (65%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 34/52 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.