DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxc4 and zen2

DIOPT Version :9

Sequence 1:NP_001103354.1 Gene:Hoxc4 / 24459 RGDID:1586210 Length:264 Species:Rattus norvegicus
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:157 Identity:54/157 - (34%)
Similarity:73/157 - (46%) Gaps:45/157 - (28%)


- Green bases have known domain annotations that are detailed below.


  Rat   134 IVYPWMK-KIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSE 197
            ::||.:: .:..:......:..:.||||||::..|::|||:|||.|:||.|.|||||:..|.|:|
  Fly    20 MMYPCVELNVEAAPTATTRSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTE 84

  Rat   198 RQIKIWFQNRRMKWKKDH----------------------------------RLPNTKVRSAPPA 228
            ||:||||||||||.||..                                  |..||.|.:||  
  Fly    85 RQVKIWFQNRRMKLKKSTNRKGAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAP-- 147

  Rat   229 GAAPSTLSAATPGTSEDHSQSATPPEQ 255
                  |.....|..|:  ...|||.|
  Fly   148 ------LRQVDHGVLEE--GQITPPYQ 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxc4NP_001103354.1 Homeobox 159..213 CDD:395001 35/53 (66%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.