DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb8 and Ubx

DIOPT Version :9

Sequence 1:NP_001178578.1 Gene:Hoxb8 / 24457 RGDID:1586211 Length:243 Species:Rattus norvegicus
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:271 Identity:87/271 - (32%)
Similarity:112/271 - (41%) Gaps:87/271 - (32%)


- Green bases have known domain annotations that are detailed below.


  Rat    16 GESLRPNYYDC-------GFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNP 73
            |..:||:  .|       |:....||.|....|.|:||:                          
  Fly   150 GMPVRPS--ACTPDSRVGGYLDTSGGSPVSHRGGSAGGN-------------------------- 186

  Rat    74 CAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWM 138
              |:..|..||..|.     ||..|.........|:|.::.|:.....|....|:.:.| .:|||
  Fly   187 --VSVSGGNGNAGGV-----QSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHT-FYPWM 243

  Rat   139 R--------------------------------PQAAAG------------RRRGRQTYSRYQTL 159
            .                                .::.||            ||||||||:|||||
  Fly   244 AIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAGSLLPDWLGTNGLRRRGRQTYTRYQTL 308

  Rat   160 ELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKEK 224
            ||||||..|.||||:||||::|||.|||||:||||||||||.|||....|..:.:.:|.:.:|..
  Fly   309 ELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEIQAIKELNEQEKQAQAQKAA 373

  Rat   225 LERAPETAEQG 235
            ...|...|.||
  Fly   374 AAAAAAAAVQG 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb8NP_001178578.1 Homeobox 150..203 CDD:395001 42/52 (81%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.