DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb8 and ftz

DIOPT Version :9

Sequence 1:NP_001178578.1 Gene:Hoxb8 / 24457 RGDID:1586211 Length:243 Species:Rattus norvegicus
Sequence 2:NP_477498.1 Gene:ftz / 40834 FlyBaseID:FBgn0001077 Length:410 Species:Drosophila melanogaster


Alignment Length:192 Identity:67/192 - (34%)
Similarity:87/192 - (45%) Gaps:64/192 - (33%)


- Green bases have known domain annotations that are detailed below.


  Rat    39 VYGPSS------GGSFQHPSQIQEFYHGPSSL------STAPYQQNPCAVACHGDPGNFYGYDPL 91
            ||.|.|      .|.|..|....     |:||      ||.|  |:|                  
  Fly   173 VYSPQSQTQKLKNGDFATPPPTT-----PTSLPPLEGISTPP--QSP------------------ 212

  Rat    92 QRQSLFGAQDPDLV-QYADCKLAAA-SGLGEEAEGSEQSPSPTQLFPWMRPQAAAG-----RRRG 149
                  |.:....| |..:.::..| :|.|:              |.|...:....     .:|.
  Fly   213 ------GEKSSSAVSQEINHRIVTAPNGAGD--------------FNWSHIEETLASDCKDSKRT 257

  Rat   150 RQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFP 211
            ||||:|||||||||||.||.|:||:|||::::||.|:|||:||||||||||.||:...|..|
  Fly   258 RQTYTRYQTLELEKEFHFNRYITRRRRIDIANALSLSERQIKIWFQNRRMKSKKDRTLDSSP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb8NP_001178578.1 Homeobox 150..203 CDD:395001 39/52 (75%)
ftzNP_477498.1 FTZ 1..248 CDD:281812 23/119 (19%)
Homeobox 257..310 CDD:278475 39/52 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.