DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb8 and Scr

DIOPT Version :9

Sequence 1:NP_001178578.1 Gene:Hoxb8 / 24457 RGDID:1586211 Length:243 Species:Rattus norvegicus
Sequence 2:NP_001368995.1 Gene:Scr / 40833 FlyBaseID:FBgn0003339 Length:564 Species:Drosophila melanogaster


Alignment Length:228 Identity:84/228 - (36%)
Similarity:104/228 - (45%) Gaps:65/228 - (28%)


- Green bases have known domain annotations that are detailed below.


  Rat     7 NSLFSKYKTGESLRPNYYDCGFAQDLGGR---PTVVYGPSS--------------GGSFQHPSQI 54
            ||..|.....:||       ...|||..|   |.:  .|||              |||.      
  Fly   192 NSANSNNNNSQSL-------ASPQDLSTRDISPKL--SPSSVVESVARSLNKGVLGGSL------ 241

  Rat    55 QEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLG 119
                  .::.:.|....|.......|.|||.  ..|:...   |..|.|          :.|..|
  Fly   242 ------AAAAAAAGLNNNHSGSGVSGGPGNV--NVPMHSP---GGGDSD----------SESDSG 285

  Rat   120 EEAEGSEQS----PSPTQLFPWMR--------PQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLT 172
            .||..|:.|    .:|.|::|||:        ..|....:|.|.:|:|||||||||||.||.|||
  Fly   286 NEAGSSQNSGNGKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLT 350

  Rat   173 RKRRIEVSHALGLTERQVKIWFQNRRMKWKKEN 205
            |:||||::|||.|||||:||||||||||||||:
  Fly   351 RRRRIEIAHALCLTERQIKIWFQNRRMKWKKEH 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb8NP_001178578.1 Homeobox 150..203 CDD:395001 42/52 (81%)
ScrNP_001368995.1 Homeobox 328..381 CDD:395001 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.