DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hoxb8 and unpg

DIOPT Version :9

Sequence 1:NP_001178578.1 Gene:Hoxb8 / 24457 RGDID:1586211 Length:243 Species:Rattus norvegicus
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:144 Identity:43/144 - (29%)
Similarity:64/144 - (44%) Gaps:36/144 - (25%)


- Green bases have known domain annotations that are detailed below.


  Rat    78 CHGD----------PGNFYGYDPLQRQSLFGAQDPDLVQYADC-------KLAAASGL-GEEAEG 124
            |.||          |.|:.|.....|...:...|.:     ||       ......|: |::::|
  Fly   251 CSGDSCSDISLTMSPRNYNGEMDKSRNGAYTNSDSE-----DCSDDEGAQSRHEGGGMGGKDSQG 310

  Rat   125 SEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQ 189
            :..|.:             :..||.|..::..|.||||:||....||:...|.:::.:|.|:|.|
  Fly   311 NGSSSN-------------SKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQ 362

  Rat   190 VKIWFQNRRMKWKK 203
            |||||||||.|||:
  Fly   363 VKIWFQNRRAKWKR 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hoxb8NP_001178578.1 Homeobox 150..203 CDD:395001 26/52 (50%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 24/50 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.