DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FRK and BCK1

DIOPT Version :9

Sequence 1:NP_002022.1 Gene:FRK / 2444 HGNCID:3955 Length:505 Species:Homo sapiens
Sequence 2:NP_012440.1 Gene:BCK1 / 853350 SGDID:S000003631 Length:1478 Species:Saccharomyces cerevisiae


Alignment Length:275 Identity:78/275 - (28%)
Similarity:134/275 - (48%) Gaps:52/275 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   240 LGSGQFGEVWEGLWNNTT--PVAVKTLK-PGSMDPNDFL--------REAQIMKNLRHPKLIQLY 293
            :|.|.||.|:..| |.||  .:|||.:: |.....|:.:        .|...:|:|.|..::| |
Yeast  1181 IGKGSFGAVYLCL-NVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQ-Y 1243

Human   294 AVCTLEDPIY-IITELMRHGSLQEYLQNDTGSKIHLTQQVD------MAAQVASGMAYLESRNYI 351
            .....::.|| :..|.:..||:        ||.|.:..:.|      :..||..|:|||.|:..:
Yeast  1244 LGFENKNNIYSLFLEYVAGGSV--------GSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGIL 1300

Human   352 HRDLAARNVLVGEHNIYKVADFGLARVFKVDNEDIY-ESRHEIKLPVKWTAPEAIRSNK-FSIKS 414
            |||:.|.|:|:.:..|.|::|||::|    .::||| .|...::..|.|.|||.:.:.: :|.|.
Yeast  1301 HRDMKADNLLLDQDGICKISDFGISR----KSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKV 1361

Human   415 DVWSFGILLYEIITYGKMPYSGMTGAQVIQMLAQNYRLPQPSNCP-----------QQFYNIMLE 468
            |:||.|.::.|:.. ||.|:|.      ::::|..:::.:..:.|           |...|.:..
Yeast  1362 DIWSLGCIVLEMFA-GKRPWSN------LEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDA 1419

Human   469 CWNAEPKERPTFETL 483
            |:...|::|||...|
Yeast  1420 CFEINPEKRPTANEL 1434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FRKNP_002022.1 SH3_Src_like 47..104 CDD:212779
SH2_Src_Frk 112..207 CDD:199831
PTKc_Frk_like 225..494 CDD:270653 78/275 (28%)
BCK1NP_012440.1 STKc_Bck1_like 1173..1440 CDD:270799 78/275 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.