DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FRK and LSB1

DIOPT Version :9

Sequence 1:NP_002022.1 Gene:FRK / 2444 HGNCID:3955 Length:505 Species:Homo sapiens
Sequence 2:NP_011652.1 Gene:LSB1 / 853037 SGDID:S000003368 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:79 Identity:27/79 - (34%)
Similarity:39/79 - (49%) Gaps:9/79 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    37 SPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARHLEKRRDGSSQQLQGYIP 101
            |||:.....|..||:|::|:...|||.:.|||:|||:.:...|:         .|.|....|..|
Yeast    48 SPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWY---------RGKSNNKIGIFP 103

Human   102 SNYVAEDRSLQAEP 115
            :|||....:..|.|
Yeast   104 ANYVKPAFTRSASP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FRKNP_002022.1 SH3_Src_like 47..104 CDD:212779 18/56 (32%)
SH2_Src_Frk 112..207 CDD:199831 2/4 (50%)
PTKc_Frk_like 225..494 CDD:270653
LSB1NP_011652.1 SH3 55..108 CDD:214620 21/61 (34%)
PRK14971 <100..>156 CDD:237874 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.