DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 4933405O20Rik and CG32026

DIOPT Version :9

Sequence 1:NP_766489.1 Gene:4933405O20Rik / 243996 MGIID:2142174 Length:396 Species:Mus musculus
Sequence 2:NP_729420.1 Gene:CG32026 / 317829 FlyBaseID:FBgn0052026 Length:719 Species:Drosophila melanogaster


Alignment Length:345 Identity:127/345 - (36%)
Similarity:213/345 - (61%) Gaps:17/345 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse    49 GGRHTVAMIPGDGIGPELMVHVKKIFRSNCVPVDFEEVWVTSTSNEEEINN----ALMAIRRNRV 109
            |....:.::||||||||:.:.|.||..:...|:.||.|.||...|.:.:.:    .:.::.|.:|
  Fly   380 GEPRVITLMPGDGIGPEISMAVIKILEAAKTPLIFEPVDVTPVLNSQGMTSVPEQVIESMNRTKV 444

Mouse   110 ALKGNIATNHNLPARYKSHNTKFRTILDLYASVVHFKTFPGVMTRHKDIDILVVRENTEGEYTNL 174
            .|||.:.|  .:...::|.|...|.:.:|||::...::.|||.|.:.|:||:.:||||||||:.:
  Fly   445 GLKGPLMT--PVGTGFRSLNLTLRQLFNLYANIRPCRSLPGVETVYGDVDIVTIRENTEGEYSGI 507

Mouse   175 EHESVKGVVESLKIVTKTKSVRIADYAFKLAQKMGRKKVTVVHKANIMKLGDGLFLQCCKDVAAH 239
            ||..|.|||:|:|::|:..|:|:|:|.|:.|..|.|||||.|.::.:|::.|||||:|.:::||.
  Fly   508 EHTLVNGVVQSIKLITRNASLRVAEYTFQYALAMKRKKVTAVAESQVMRMSDGLFLRCVREMAAK 572

Mouse   240 YPQ------ITLESMIIDNTTMQLVSKPQQFDVMVMPNLYGNIINSICTGLVGGSGIVPGANYGD 298
            |..      |..|...:....:.:|..|:::|::|:|||||:||:..|.||:||.|:.|..|.|.
  Fly   573 YKSKMDQAGIKYEESTMTTVCLNIVQDPKRYDMLVLPNLYGDIISDTCAGLIGGLGLTPSGNVGT 637

Mouse   299 SYAIFEM--GSKEIGKDLAHRNIANPVAMLLTSCIMLDYLDLQPYATHIRSAVMASLQNKAVCTP 361
            :.||||.  |:   ..|:|.:::|||.|:||:|.:||.|:.|..:|..|..||:.::::..:.|.
  Fly   638 NGAIFESVHGT---APDIAGKDLANPTALLLSSVMMLHYIGLHEHADKIEKAVLKTIRDDNIRTM 699

Mouse   362 DIGGQGNTASTVEYILHHMK 381
            |:||:...:...:.::.::|
  Fly   700 DLGGKAKCSEYTDALIKNLK 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
4933405O20RikNP_766489.1 Iso_dh 49..380 CDD:294303 126/342 (37%)
CG32026NP_729420.1 FGF-BP1 <281..361 CDD:284004
Iso_dh 382..718 CDD:294303 125/340 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0473
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D325037at33208
OrthoFinder 1 1.000 - - FOG0000244
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X402
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.