Sequence 1: | NP_766486.1 | Gene: | Kirrel2 / 243911 | MGIID: | 2442334 | Length: | 700 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001033956.2 | Gene: | dpr13 / 3885598 | FlyBaseID: | FBgn0034286 | Length: | 419 | Species: | Drosophila melanogaster |
Alignment Length: | 427 | Identity: | 85/427 - (19%) |
---|---|---|---|
Similarity: | 125/427 - (29%) | Gaps: | 139/427 - (32%) |
- Green bases have known domain annotations that are detailed below.
Mouse 200 ICRARSQALPTGRDTAVTLSLQYPPMVTLSAEPQT-----------VQEGEKVTFLCQATAQPPV 253
Mouse 254 TGYRWAKGGSPVL---------GARGPRLEVVADATFLT----------------------EPVS 287
Mouse 288 --CEVSNAVGSANRSTALEVLYG-PILQAKPKS--VSVDVGKDASFSCVWRGNPLPRITWTRMGG 347
Mouse 348 SQVLSSGP--------------------TLRLPSVALEDAGDYVCRAE---PRRTGLGGGKAQAR 389
Mouse 390 LTVNAPPVVTALQPAPAFLRGPARLQC-VVFASPAPDSVVWSWDEGFLEAGSLGRFLVEAFPAPE 453
Mouse 454 VEGGQGPGLISVLHISGTQESDFTTGFNCSARNRLGEGRVQIHLGRRDLLPTVRIVAGAASAATS 518
Mouse 519 LLMVITGVVLCCWRHGSLSKQKNLVRIPGSSEGSSSR 555 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kirrel2 | NP_766486.1 | IG | 27..116 | CDD:214652 | |
Ig | 122..220 | CDD:416386 | 6/19 (32%) | ||
Ig strand A | 123..126 | CDD:409353 | |||
Ig strand A' | 129..133 | CDD:409353 | |||
Ig strand B | 140..147 | CDD:409353 | |||
Cell attachment site. /evidence=ECO:0000255 | 146..148 | ||||
Ig strand C | 153..158 | CDD:409353 | |||
Ig strand C' | 161..163 | CDD:409353 | |||
Ig strand D | 166..173 | CDD:409353 | |||
Ig strand E | 180..188 | CDD:409353 | |||
Ig strand F | 197..205 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 211..217 | CDD:409353 | 2/5 (40%) | ||
Ig_3 | 223..292 | CDD:404760 | 22/112 (20%) | ||
Ig strand B | 241..245 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 255..259 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 272..275 | CDD:409353 | 0/2 (0%) | ||
Ig strand F | 281..290 | CDD:409353 | 4/32 (13%) | ||
Ig strand G | 298..301 | CDD:409353 | 0/2 (0%) | ||
Ig | 315..392 | CDD:416386 | 22/101 (22%) | ||
Ig strand A' | 316..321 | CDD:409353 | 2/6 (33%) | ||
Ig strand B | 324..333 | CDD:409353 | 2/8 (25%) | ||
Ig strand C | 339..343 | CDD:409353 | 0/3 (0%) | ||
Ig strand C' | 346..348 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 351..354 | CDD:409353 | 1/2 (50%) | ||
Ig strand E | 355..360 | CDD:409353 | 2/24 (8%) | ||
Ig strand F | 368..376 | CDD:409353 | 3/10 (30%) | ||
Ig strand G | 382..392 | CDD:409353 | 2/9 (22%) | ||
Ig | 394..498 | CDD:416386 | 18/104 (17%) | ||
Ig strand A | 395..399 | CDD:409353 | 2/3 (67%) | ||
Ig strand A' | 401..404 | CDD:409353 | 1/2 (50%) | ||
Ig strand B | 412..419 | CDD:409353 | 5/7 (71%) | ||
Ig strand C | 426..431 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 433..436 | CDD:409353 | 0/2 (0%) | ||
Ig strand D | 444..451 | CDD:409353 | 0/6 (0%) | ||
Ig strand E | 461..468 | CDD:409353 | 0/6 (0%) | ||
Ig strand F | 479..486 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 489..496 | CDD:409353 | 0/6 (0%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 542..576 | 3/14 (21%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 671..700 | ||||
dpr13 | NP_001033956.2 | V-set | 180..276 | CDD:284989 | 20/95 (21%) |
IG_like | 182..262 | CDD:214653 | 18/79 (23%) | ||
IG_like | 285..362 | CDD:214653 | 22/118 (19%) | ||
IGc2 | 292..361 | CDD:197706 | 19/109 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |