DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Kirrel2 and babos

DIOPT Version :9

Sequence 1:	NP_766486.1	Gene:	Kirrel2 / 243911	MGIID:	2442334	Length:	700	Species:	Mus musculus
Sequence 2:	NP_001286719.1	Gene:	babos / 37557	FlyBaseID:	FBgn0034724	Length:	196	Species:	Drosophila melanogaster

Alignment Length:	152	Identity:	35/152 - (23%)
Similarity:	54/152 - (35%)	Gaps:	46/152 - (30%)

- Green bases have known domain annotations that are detailed below.

Mouse   292 NAVGSANRSTALEVLYGPILQAKPKSVSVDVGKDASFSCVWRGNPLPRITWTRMGGSQVLSSGPT 356
            |.|.|...:..|.|..   ::.:...:..|||.:...|.|       .:.|  ..|..|:|:|..
  Fly    58 NPVASEKINKTLSVTG---IRGEDVVLKCDVGSNLHSSDV-------VVLW--YFGDNVISNGKN 110

Mouse   357 LRLPSVALED-------------AGDYVCRAEPRRTGLGGGKAQARLTVNAPPVVTALQP----- 403
            |..|:..|:.             ||.|:|:..|     .|.....::|: |...:.|:.|
  Fly   111 LVQPNFKLDANYDLTILKASPQVAGSYLCKVLP-----SGSVVNTKVTI-AEHSLDAIAPESSTS 169

Mouse   404 ----APAFLRGPARLQCVVFAS 421
                |.:|      |.|.|.||
  Fly   170 AAGSASSF------LGCTVLAS 185

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Kirrel2	NP_766486.1	IG	27..116	CDD:214652
		Ig	122..220	CDD:416386
		Ig strand A	123..126	CDD:409353
		Ig strand A'	129..133	CDD:409353
		Ig strand B	140..147	CDD:409353
		Cell attachment site. /evidence=ECO:0000255	146..148
		Ig strand C	153..158	CDD:409353
		Ig strand C'	161..163	CDD:409353
		Ig strand D	166..173	CDD:409353
		Ig strand E	180..188	CDD:409353
		Ig strand F	197..205	CDD:409353
		Ig strand G	211..217	CDD:409353
		Ig_3	223..292	CDD:404760	35/152 (23%)
		Ig strand B	241..245	CDD:409353
		Ig strand C	255..259	CDD:409353
		Ig strand E	272..275	CDD:409353
		Ig strand F	281..290	CDD:409353
		Ig strand G	298..301	CDD:409353	0/2 (0%)
		Ig	315..392	CDD:416386	19/89 (21%)
		Ig strand A'	316..321	CDD:409353	0/4 (0%)
		Ig strand B	324..333	CDD:409353	2/8 (25%)
		Ig strand C	339..343	CDD:409353	0/3 (0%)
		Ig strand C'	346..348	CDD:409353	0/1 (0%)
		Ig strand D	351..354	CDD:409353	1/2 (50%)
		Ig strand E	355..360	CDD:409353	1/4 (25%)
		Ig strand F	368..376	CDD:409353	3/7 (43%)
		Ig strand G	382..392	CDD:409353	1/9 (11%)
		Ig	394..498	CDD:416386	10/37 (27%)
		Ig strand A	395..399	CDD:409353	0/3 (0%)
		Ig strand A'	401..404	CDD:409353	1/11 (9%)
		Ig strand B	412..419	CDD:409353	2/6 (33%)
		Ig strand C	426..431	CDD:409353
		Ig strand C'	433..436	CDD:409353
		Ig strand D	444..451	CDD:409353
		Ig strand E	461..468	CDD:409353
		Ig strand F	479..486	CDD:409353
		Ig strand G	489..496	CDD:409353
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	542..576
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	671..700
babos	NP_001286719.1	ig	70..154	CDD:278476	20/100 (20%)
babos	NP_001286719.1	IG_like	70..154	CDD:214653	20/100 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900