Sequence 1: | NP_766486.1 | Gene: | Kirrel2 / 243911 | MGIID: | 2442334 | Length: | 700 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286719.1 | Gene: | babos / 37557 | FlyBaseID: | FBgn0034724 | Length: | 196 | Species: | Drosophila melanogaster |
Alignment Length: | 152 | Identity: | 35/152 - (23%) |
---|---|---|---|
Similarity: | 54/152 - (35%) | Gaps: | 46/152 - (30%) |
- Green bases have known domain annotations that are detailed below.
Mouse 292 NAVGSANRSTALEVLYGPILQAKPKSVSVDVGKDASFSCVWRGNPLPRITWTRMGGSQVLSSGPT 356
Mouse 357 LRLPSVALED-------------AGDYVCRAEPRRTGLGGGKAQARLTVNAPPVVTALQP----- 403
Mouse 404 ----APAFLRGPARLQCVVFAS 421 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |