Sequence 1: | NP_766486.1 | Gene: | Kirrel2 / 243911 | MGIID: | 2442334 | Length: | 700 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
Alignment Length: | 386 | Identity: | 93/386 - (24%) |
---|---|---|---|
Similarity: | 142/386 - (36%) | Gaps: | 106/386 - (27%) |
- Green bases have known domain annotations that are detailed below.
Mouse 171 QTTLKDKATGTVE-----------NTLFLTPSSH----DDGATLICRARSQALPTGRDTAVTLSL 220
Mouse 221 QYPP-MVTLSAEPQTVQEGEKVTFLCQATAQPPVTGYRWAKGGSPVLGARGPRLEVVADATFLTE 284
Mouse 285 PVSCEVSNAVGSANRSTALEVLYGPIL-QAKPKSVSVDVGKDASFSCVWRGNPLPRITWTRMGGS 348
Mouse 349 QVLSS------GPTLRLPSVALEDAGDYVCRAEPRRTGLG-GGKAQARLTVNAPPVVTALQPAPA 406
Mouse 407 F---LRGPARLQCVVFASPAPDSVVWSWDEGFLEAGSLGRFLVEAFPAPEVEGGQGPGLISVLHI 468
Mouse 469 SGTQESDFTTGFNCSARNRLGEGRVQIHLGRRDLLPTV------RIVAGAAS-AATSLLMV 522 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kirrel2 | NP_766486.1 | IG | 27..116 | CDD:214652 | |
Ig | 122..220 | CDD:416386 | 16/63 (25%) | ||
Ig strand A | 123..126 | CDD:409353 | |||
Ig strand A' | 129..133 | CDD:409353 | |||
Ig strand B | 140..147 | CDD:409353 | |||
Cell attachment site. /evidence=ECO:0000255 | 146..148 | ||||
Ig strand C | 153..158 | CDD:409353 | |||
Ig strand C' | 161..163 | CDD:409353 | |||
Ig strand D | 166..173 | CDD:409353 | 1/1 (100%) | ||
Ig strand E | 180..188 | CDD:409353 | 6/18 (33%) | ||
Ig strand F | 197..205 | CDD:409353 | 2/7 (29%) | ||
Ig strand G | 211..217 | CDD:409353 | 1/5 (20%) | ||
Ig_3 | 223..292 | CDD:404760 | 11/69 (16%) | ||
Ig strand B | 241..245 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 255..259 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 272..275 | CDD:409353 | 0/2 (0%) | ||
Ig strand F | 281..290 | CDD:409353 | 2/8 (25%) | ||
Ig strand G | 298..301 | CDD:409353 | 0/2 (0%) | ||
Ig | 315..392 | CDD:416386 | 26/83 (31%) | ||
Ig strand A' | 316..321 | CDD:409353 | 2/4 (50%) | ||
Ig strand B | 324..333 | CDD:409353 | 1/8 (13%) | ||
Ig strand C | 339..343 | CDD:409353 | 2/3 (67%) | ||
Ig strand C' | 346..348 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 351..354 | CDD:409353 | 1/8 (13%) | ||
Ig strand E | 355..360 | CDD:409353 | 3/4 (75%) | ||
Ig strand F | 368..376 | CDD:409353 | 4/7 (57%) | ||
Ig strand G | 382..392 | CDD:409353 | 1/10 (10%) | ||
Ig | 394..498 | CDD:416386 | 24/106 (23%) | ||
Ig strand A | 395..399 | CDD:409353 | 2/3 (67%) | ||
Ig strand A' | 401..404 | CDD:409353 | 0/2 (0%) | ||
Ig strand B | 412..419 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 426..431 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 433..436 | CDD:409353 | 0/2 (0%) | ||
Ig strand D | 444..451 | CDD:409353 | 1/6 (17%) | ||
Ig strand E | 461..468 | CDD:409353 | 1/6 (17%) | ||
Ig strand F | 479..486 | CDD:409353 | 2/6 (33%) | ||
Ig strand G | 489..496 | CDD:409353 | 2/6 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 542..576 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 671..700 | ||||
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 31/149 (21%) |
FR1 | 37..50 | CDD:409353 | 6/13 (46%) | ||
Ig strand A' | 37..42 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 44..51 | CDD:409353 | 4/6 (67%) | ||
CDR1 | 51..59 | CDD:409353 | 0/7 (0%) | ||
Ig strand C | 59..63 | CDD:409353 | 2/3 (67%) | ||
FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
CDR2 | 67..81 | CDD:409353 | 4/23 (17%) | ||
Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/11 (0%) | ||
FR3 | 84..115 | CDD:409353 | 9/30 (30%) | ||
Ig strand D | 84..90 | CDD:409353 | 2/5 (40%) | ||
Ig strand E | 94..102 | CDD:409353 | 1/7 (14%) | ||
Ig strand F | 108..115 | CDD:409353 | 2/6 (33%) | ||
CDR3 | 116..124 | CDD:409353 | 0/38 (0%) | ||
FR4 | 124..130 | CDD:409353 | 3/16 (19%) | ||
Ig strand G | 124..130 | CDD:409353 | 3/16 (19%) | ||
Ig_3 | 134..208 | CDD:404760 | 25/77 (32%) | ||
Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 166..170 | CDD:409353 | 2/3 (67%) | ||
Ig strand E | 187..191 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 201..206 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 23/102 (23%) | ||
Ig strand C | 256..260 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 286..290 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 300..305 | CDD:409353 | 2/8 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |