| Sequence 1: | NP_766486.1 | Gene: | Kirrel2 / 243911 | MGIID: | 2442334 | Length: | 700 | Species: | Mus musculus |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001188701.2 | Gene: | DIP-eta / 33793 | FlyBaseID: | FBgn0031725 | Length: | 450 | Species: | Drosophila melanogaster |
| Alignment Length: | 388 | Identity: | 93/388 - (23%) |
|---|---|---|---|
| Similarity: | 150/388 - (38%) | Gaps: | 104/388 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Mouse 21 PHFLQQPEDMVVLLGEEARLPCA---LGAYRGLVQW----TKDGLALGGERDLPGWSRYWISGNS 78
Mouse 79 ----ASGQH---DLHIKPVELEDEASYECQASQAGLRSRPAQLHVMVPPEAPQVLGGP-SVSLVA 135
Mouse 136 GVPGNLTCRSRGDSRPAPELLWFRD-GIRLDGSSFHQTTLKDKATG----TVENTLFLTPS--SH 193
Mouse 194 DDGATLICRARSQALPTGRDTAVTLSLQYPPMVTLSAEPQTVQEGEKVTFLCQATAQPPVTGYRW 258
Mouse 259 AKGGSPVLGARGPRLEVVADATFLTEPVSCEVSNAVGSANRSTALEVLYGPILQAKPKSVSVDVG 323
Mouse 324 KDASFSCVWRGNPLPRITWTRMGGSQVLSSGPT------LRLPSVALEDAGDYVCRAEPRRTG 380 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Kirrel2 | NP_766486.1 | IG | 27..116 | CDD:214652 | 24/102 (24%) |
| Ig | 122..220 | CDD:416386 | 27/105 (26%) | ||
| Ig strand A | 123..126 | CDD:409353 | 0/2 (0%) | ||
| Ig strand A' | 129..133 | CDD:409353 | 2/4 (50%) | ||
| Ig strand B | 140..147 | CDD:409353 | 2/6 (33%) | ||
| Cell attachment site. /evidence=ECO:0000255 | 146..148 | 0/1 (0%) | |||
| Ig strand C | 153..158 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 161..163 | CDD:409353 | 1/1 (100%) | ||
| Ig strand D | 166..173 | CDD:409353 | 0/6 (0%) | ||
| Ig strand E | 180..188 | CDD:409353 | 3/11 (27%) | ||
| Ig strand F | 197..205 | CDD:409353 | 4/7 (57%) | ||
| Ig strand G | 211..217 | CDD:409353 | 0/5 (0%) | ||
| Ig_3 | 223..292 | CDD:404760 | 16/68 (24%) | ||
| Ig strand B | 241..245 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 255..259 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 272..275 | CDD:409353 | 0/2 (0%) | ||
| Ig strand F | 281..290 | CDD:409353 | 0/8 (0%) | ||
| Ig strand G | 298..301 | CDD:409353 | 0/2 (0%) | ||
| Ig | 315..392 | CDD:416386 | 14/72 (19%) | ||
| Ig strand A' | 316..321 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 324..333 | CDD:409353 | 3/8 (38%) | ||
| Ig strand C | 339..343 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 346..348 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 351..354 | CDD:409353 | 1/2 (50%) | ||
| Ig strand E | 355..360 | CDD:409353 | 2/10 (20%) | ||
| Ig strand F | 368..376 | CDD:409353 | 2/7 (29%) | ||
| Ig strand G | 382..392 | CDD:409353 | |||
| Ig | 394..498 | CDD:416386 | |||
| Ig strand A | 395..399 | CDD:409353 | |||
| Ig strand A' | 401..404 | CDD:409353 | |||
| Ig strand B | 412..419 | CDD:409353 | |||
| Ig strand C | 426..431 | CDD:409353 | |||
| Ig strand C' | 433..436 | CDD:409353 | |||
| Ig strand D | 444..451 | CDD:409353 | |||
| Ig strand E | 461..468 | CDD:409353 | |||
| Ig strand F | 479..486 | CDD:409353 | |||
| Ig strand G | 489..496 | CDD:409353 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 542..576 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 671..700 | ||||
| DIP-eta | NP_001188701.2 | Ig | 51..141 | CDD:299845 | 24/100 (24%) |
| IG_like | 51..137 | CDD:214653 | 23/96 (24%) | ||
| IG_like | 153..237 | CDD:214653 | 25/96 (26%) | ||
| Ig | 161..224 | CDD:299845 | 20/75 (27%) | ||
| IG_like | 252..335 | CDD:214653 | 24/127 (19%) | ||
| Ig | 258..333 | CDD:143165 | 22/119 (18%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||