DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel2 and sdk

DIOPT Version :9

Sequence 1:NP_766486.1 Gene:Kirrel2 / 243911 MGIID:2442334 Length:700 Species:Mus musculus
Sequence 2:NP_001284756.1 Gene:sdk / 31017 FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster


Alignment Length:805 Identity:172/805 - (21%)
Similarity:274/805 - (34%) Gaps:285/805 - (35%)


- Green bases have known domain annotations that are detailed below.


Mouse    20 SPHFLQQPEDMVVLLGE-EARLPCALGAYRGLVQ----WTKDGLAL--GGERDL--PGWSR--YW 73
            :|..:.:|:|:.|.:|. ...|.|...| |.|.:    |.|||||:  .|.|..  ..|:|  ..
  Fly   260 APEIIVRPQDVKVKVGTGVVELQCIANA-RPLHELETLWLKDGLAVETAGVRHTLNDPWNRTLAL 323

Mouse    74 ISGNSA-SGQHDLHIKPVELEDEASYECQASQAGLR-------SRPAQLHVMVPPEAPQVLGGPS 130
            :..||: ||:               |.||..   ||       |..|:|.::.||    :...|.
  Fly   324 LQANSSHSGE---------------YTCQVR---LRSGGYPAVSASARLQILEPP----LFFTPM 366

Mouse   131 VSLVAGVPG---NLTCRSRGDSRPAPELLWFRDGIRLDGSSFHQTTLKDKATGTVENTLFLTPSS 192
            .:...|..|   .|||...|:  |.|::.|||:...:|.   |..:  .:.|...:|||.:....
  Fly   367 RAETFGEFGGQVQLTCDVVGE--PTPQVKWFRNAESVDA---HIES--GRYTLNTDNTLVIKKLI 424

Mouse   193 HDDGATLICRARSQALPTGRDTAVTLSLQYPPMVTLSAEPQTVQEGEKVTFLCQATAQPPVTGYR 257
            .||.|...|.|.::|   |.::|.|         .|..:.:|.:...|      ..|||.:...|
  Fly   425 LDDAAMFQCLAINEA---GENSAST---------WLRVKTKTAKNRVK------RLAQPRILRVR 471

Mouse   258 WAKGGSPVLGARGPRLEVVADATFLTEPVSCEVSNAVGSANRSTALEVLYGPILQAKPKSVSVDV 322
            .:..|   ||:                    |..:..||::|.........||::..|::|:...
  Fly   472 ASHAG---LGS--------------------EKGSESGSSDRRKEFRFASAPIMELPPQNVTALD 513

Mouse   323 GKDASFSCVWRGNPLPRITW----TRM----GGSQVLSSGPTLRLPSVALEDAGDYVCRAEPRRT 379
            ||||:.||...|:|.|.|||    |::    ...|:|.||..| :.::...|||.|:|   .|..
  Fly   514 GKDATISCRAVGSPNPNITWIYNETQLVDISSRVQILESGDLL-ISNIRSVDAGLYIC---VRAN 574

Mouse   380 GLGGGKAQARLTVNA------PPVVTALQPAPAFLRGPARLQCVVFASPA-PDSVVW-------- 429
            ..|..|.:|.|:|..      |||.|.:     .|...|.|||.|.:.|: |.::.|        
  Fly   575 EAGSVKGEAYLSVLVRTQIIQPPVDTTV-----LLGLTATLQCKVSSDPSVPYNIDWYREGQSST 634

Mouse   430 ----------------------------------------------------------------- 429
                                                                             
  Fly   635 PISNSQRIGVQADGQLEIQAVRASDVGSYACVVTSPGGNETRAARLSVIELPFPPSNVKVERLPE 699

Mouse   430 --------SWDEGFLEAGSLGRFLVEAFPAPEVEGGQGP-------GLISVLHISGTQ------- 472
                    ||..||.....:.:|:::.....|:    ||       .:..:.::|..|       
  Fly   700 PQQRSINVSWTPGFDGNSPISKFIIQRREVSEL----GPVPDPLLNWITELSNVSADQRWILLEN 760

Mouse   473 -ESDFTTGFNCSARNRLGEGRVQ-----IHLGRRDLLPTVRIVAGAASAATSLLMVITGVVLCCW 531
             ::.....|..||.||:|||...     :.|.:.  .|:...| |...:|.|:..:||.     |
  Fly   761 LKAATVYQFRVSAVNRVGEGSPSEPSNVVELPQE--APSGPPV-GFVGSARSMSEIITQ-----W 817

Mouse   532 RHGSLSKQKN------LVR--------IPGSSEGSSSRGPEE--------------ETGSSEDRG 568
            : ..|.:.:|      ::|        :|.|.:..::.....              :..:..:.|
  Fly   818 Q-PPLEEHRNGQILGYILRYRLFGYNNVPWSYQNITNEAQRNFLIQELITWKDYIVQIAAYNNMG 881

Mouse   569 PIVHTDHSDLVLEEKEALETKDPTNGYYRVRGVSVSLSLGEAPGGGLFLPPPSPIGLPGTPTYY- 632
            ..|:|:.|.  ::.||.:....|||         |.:....:........||:|..:.|....| 
  Fly   882 VGVYTEGSK--IKTKEGVPEAPPTN---------VKVEAINSTAARCRWTPPNPQQINGINQGYK 935

Mouse   633 --------------DFKPHLDLVPP 643
                          |.:..:..|||
  Fly   936 IQAWQRRLIDGEWRDIERRMKTVPP 960

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kirrel2NP_766486.1 IG 27..116 CDD:214652 31/107 (29%)
Ig 122..220 CDD:416386 27/100 (27%)
Ig strand A 123..126 CDD:409353 0/2 (0%)
Ig strand A' 129..133 CDD:409353 1/3 (33%)
Ig strand B 140..147 CDD:409353 3/6 (50%)
Cell attachment site. /evidence=ECO:0000255 146..148 0/1 (0%)
Ig strand C 153..158 CDD:409353 1/4 (25%)
Ig strand C' 161..163 CDD:409353 0/1 (0%)
Ig strand D 166..173 CDD:409353 1/6 (17%)
Ig strand E 180..188 CDD:409353 3/7 (43%)
Ig strand F 197..205 CDD:409353 3/7 (43%)
Ig strand G 211..217 CDD:409353 2/5 (40%)
Ig_3 223..292 CDD:404760 11/68 (16%)
Ig strand B 241..245 CDD:409353 0/3 (0%)
Ig strand C 255..259 CDD:409353 1/3 (33%)
Ig strand E 272..275 CDD:409353 0/2 (0%)
Ig strand F 281..290 CDD:409353 0/8 (0%)
Ig strand G 298..301 CDD:409353 1/2 (50%)
Ig 315..392 CDD:416386 30/84 (36%)
Ig strand A' 316..321 CDD:409353 1/4 (25%)
Ig strand B 324..333 CDD:409353 5/8 (63%)
Ig strand C 339..343 CDD:409353 3/7 (43%)
Ig strand C' 346..348 CDD:409353 0/1 (0%)
Ig strand D 351..354 CDD:409353 1/2 (50%)
Ig strand E 355..360 CDD:409353 1/4 (25%)
Ig strand F 368..376 CDD:409353 3/7 (43%)
Ig strand G 382..392 CDD:409353 4/9 (44%)
Ig 394..498 CDD:416386 31/211 (15%)
Ig strand A 395..399 CDD:409353 3/3 (100%)
Ig strand A' 401..404 CDD:409353 0/2 (0%)
Ig strand B 412..419 CDD:409353 4/6 (67%)
Ig strand C 426..431 CDD:409353 1/85 (1%)
Ig strand C' 433..436 CDD:409353 1/2 (50%)
Ig strand D 444..451 CDD:409353 1/6 (17%)
Ig strand E 461..468 CDD:409353 0/6 (0%)
Ig strand F 479..486 CDD:409353 3/6 (50%)
Ig strand G 489..496 CDD:409353 3/11 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..576 6/55 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 671..700
sdkNP_001284756.1 Ig 71..157 CDD:299845
I-set 72..150 CDD:254352
Ig 172..245 CDD:299845
IG_like 280..356 CDD:214653 27/94 (29%)
Ig 280..343 CDD:299845 24/81 (30%)
IG_like 375..450 CDD:214653 26/93 (28%)
Ig 378..447 CDD:143165 24/87 (28%)
Ig 506..587 CDD:299845 30/84 (36%)
IG_like 506..587 CDD:214653 30/84 (36%)
I-set 592..682 CDD:254352 13/94 (14%)
Ig 595..682 CDD:299845 13/91 (14%)
FN3 686..789 CDD:238020 18/106 (17%)
FN3 798..893 CDD:238020 16/103 (16%)
FN3 901..1005 CDD:238020 13/69 (19%)
fn3 1011..1094 CDD:278470
FN3 1108..1202 CDD:238020
FN3 1210..1308 CDD:238020
fn3 1317..1402 CDD:278470
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
fn3 1617..1708 CDD:278470
FN3 1722..1823 CDD:238020
FN3 1828..1920 CDD:238020
FN3 1927..2016 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.