DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fgg and CG9500

DIOPT Version :9

Sequence 1:XP_006232587.1 Gene:Fgg / 24367 RGDID:2613 Length:445 Species:Rattus norvegicus
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:309 Identity:88/309 - (28%)
Similarity:139/309 - (44%) Gaps:54/309 - (17%)


- Green bases have known domain annotations that are detailed below.


  Rat   122 YEALLLTHESSIRYLQDIYTSNKQKITNL-KQKVAQLEAQCQEPCKDSVRIHDTTGKDCQDIANK 185
            |....:..||   :..|....||.::.:| |..:|.||........::::      |...|:...
  Fly    16 YSTEAMDSES---FQNDTAIRNKPELKSLYKLVLALLEENQSNASTENIQ------KSSSDLNTT 71

  Rat   186 GAK------------ESGLYFIRPLKATQQFLVYCEIDGSGNGWTVLQKRLDGSVDFKKNWIQYK 238
            |..            ..|:|.::.| ..:.|.|.|:.:.:|.||||:.:|....::|.::|.:||
  Fly    72 GLSGRYPSQCPTYPPAHGIYTVQVL-GLKPFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYK 135

  Rat   239 EGFGHLSPTGTTEFWLGNEKIHLISMQSTIPYALRIQLKDWSGRTSTADYAMFRVGPESDKYRLT 303
            .|||.|.    .:|::|.:|:|.|:...  |:.|.|.|:|:.|:|..|.|....:..|:..|.:|
  Fly   136 NGFGQLD----GDFFIGLDKLHAITKSQ--PHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMT 194

  Rat   304 YAYFIGGDAGDAFDGYDFGDDPSDKFFTSHN-GMHFSTWDNDNDKFEGNCAEQDGSGWWMNKCHA 367
            ......|||||:.               .|| ..:|||:|.|||.:..||||:....||...|..
  Fly   195 KLGEFTGDAGDSM---------------IHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTY 244

  Rat   368 GHLNGVYYQG--GTYSKSSTPNGYDNGIIWATWKTRWYSMKETTMKIIP 414
            .:|.|:|.:|  |.|.:.       .||:|.:|:|..||.|...|.:.|
  Fly   245 SNLFGIYVKGDEGQYFQW-------KGIVWHSWRTESYSYKVMQMMVRP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FggXP_006232587.1 Fib_alpha 31..172 CDD:400857 11/50 (22%)
Fibrinogen_C 175..414 CDD:395095 76/253 (30%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 74/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.