DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fgb and CG9500

DIOPT Version :9

Sequence 1:XP_038957639.1 Gene:Fgb / 24366 RGDID:2604 Length:504 Species:Rattus norvegicus
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:317 Identity:92/317 - (29%)
Similarity:144/317 - (45%) Gaps:78/317 - (24%)


- Green bases have known domain annotations that are detailed below.


  Rat   160 YSSILEDQKLYIDETVNDNIP---LNLRVLRSILEDLRS-----KIQKLESDISAQTEYCHTPCT 216
            ||:...|.:.:.::|...|.|   ...:::.::||:.:|     .|||..||:            
  Fly    16 YSTEAMDSESFQNDTAIRNKPELKSLYKLVLALLEENQSNASTENIQKSSSDL------------ 68

  Rat   217 VNCNIPVVSGK---ECEEIIRKGGETSEMYLIQPDTSSKPYRVYCDMKTENGGWTVIQNRQDGSV 278
               |...:||:   :|.......|    :|.:|. ...||::|.||.:....||||:..|....:
  Fly    69 ---NTTGLSGRYPSQCPTYPPAHG----IYTVQV-LGLKPFQVSCDAEIAGTGWTVMARRTSNKL 125

  Rat   279 DFGRKWDPYKKGFGNIATNEDTKKYCGLPGEYWLGNDKISQLTRIGPTELLIEMEDWKGDKVKAH 343
            :|.|.|..||.|||.            |.|::::|.||:..:|:..|.||.|.:||::|....||
  Fly   126 NFFRSWAEYKNGFGQ------------LDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAH 178

  Rat   344 YGGFTVQTEANKY--QVSVNKYKGTAGNALMEGASQLVGENRTMTIHN-GMFFSTYDRDNDGWVT 405
            |....:::| ||:  ...:.::.|.||:::               ||| ...|||:|||||||  
  Fly   179 YDEIFIESE-NKFYAMTKLGEFTGDAGDSM---------------IHNRNQNFSTFDRDNDGW-- 225

  Rat   406 TDPRKQCSKEDGGGWWYNRCHAANPNGRYYWG--GLY-SWDMSKHGTDDGVVWMNWK 459
               .|.|::|..|.||:..|..:|..|.|..|  |.| .|        .|:||.:|:
  Fly   226 ---HKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQW--------KGIVWHSWR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FgbXP_038957639.1 Fib_alpha 80..222 CDD:400857 15/69 (22%)
FReD 225..462 CDD:412152 77/244 (32%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 75/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.