DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Styk1 and btl

DIOPT Version :9

Sequence 1:NP_766479.1 Gene:Styk1 / 243659 MGIID:2141396 Length:429 Species:Mus musculus
Sequence 2:NP_001014583.1 Gene:btl / 39564 FlyBaseID:FBgn0285896 Length:1052 Species:Drosophila melanogaster


Alignment Length:464 Identity:112/464 - (24%)
Similarity:199/464 - (42%) Gaps:89/464 - (19%)


- Green bases have known domain annotations that are detailed below.


Mouse    40 GFLILLAIILWLFIRG--------QRSQRQS--------------------PGPRGTASVPASRG 76
            ||.:....|:.||:.|        :|.:|:.                    ||  |......|.|
  Fly   602 GFTLAAITIVALFLLGSAFITFMLRRLRREKLLKLRIETVHQWTKKVIIYRPG--GEEGSGCSSG 664

Mouse    77 RSQEAAGHGEKVLLPLKETS------VEGFLRAATPRLAKLQVPREQLLEVLEQIHSGSCGTL-- 133
            ..|......||....:..|.      .:||.....|..:..::||:||          |.|::  
  Fly   665 DLQMPVIRIEKQRTTVSTTGTGGTDPAQGFNEYEFPLDSNWEIPRQQL----------SLGSILG 719

Mouse   134 ---YHATMTTKDHPKPKS-------VVLKALEDPVGLQEVQDFIGRIQFYQYLGKHKNLVQLEGC 188
               :...:..:....|:|       |.:|.:::.....::...:..::..:.:|||.|::.|.||
  Fly   720 EGAFGRVVMAEAEGLPRSPQLAETIVAVKMVKEEHTDTDMASLVREMEVMKMIGKHINIINLLGC 784

Mouse   189 CTERLPLYMMLEDVVPGDLLSFLWTCRRDV----MTMDGLLYD--------LTEKQIYHIGKQIL 241
            |::..||::::|....|:|..||...|...    ...||.|.|        |.||::.....||.
  Fly   785 CSQGGPLWVIVEYAPHGNLKDFLKQNRPGAPQRRSDSDGYLDDKPLISTQHLGEKELTKFAFQIA 849

Mouse   242 LALEFLQEKHLFHGDVAARNILIQSDLTPKLCHLGLAYEVHAHGAISSARSSTIPLKWLAPERLL 306
            ..:|:|..:...|.|:||||:|:......|:...|||.::..........:..:|:||:|||.|.
  Fly   850 RGMEYLASRRCIHRDLAARNVLVSDGYVMKIADFGLARDIQDTEYYRKNTNGRLPIKWMAPESLQ 914

Mouse   307 LRPASIRGDIWSFGILLYEMVTLGAPPYPEV-PPTSILQYLQRKKIMKRPSSCSHAMYNIMKCCW 370
            .:....:.|:||:|:||:|::|.|..|||.: ....:..||...:.|::|:.||..:|.:|:.||
  Fly   915 EKKYDSQSDVWSYGVLLWEIMTYGDQPYPHILSAEELYSYLITGQRMEKPAKCSLNIYVVMRQCW 979

Mouse   371 RWSEDSRPLLGQLLQR----LEAASRSADDKAV-LQVPELVVP------------ELYADVAGIR 418
            .:...:||...:|::.    |:.||.:.:|..: |.:|.|..|            |.:.:.:.:|
  Fly   980 HFESCARPTFAELVESFDGILQQASSNPNDAYLDLSMPMLETPPSSGDEDDGSDTETFRETSPLR 1044

Mouse   419 AESISYSFS 427
            .: .:|.|:
  Fly  1045 YQ-YTYKFN 1052

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Styk1NP_766479.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..83 7/44 (16%)
PKc_like 123..388 CDD:389743 76/293 (26%)
btlNP_001014583.1 IG_like 149..232 CDD:214653
IGc2 157..215 CDD:197706
IG 247..336 CDD:214652
Ig 258..340 CDD:143165
I-set 394..479 CDD:254352
IGc2 408..469 CDD:197706
IG_like 492..583 CDD:214653
Ig 507..583 CDD:299845
PKc_like 700..1000 CDD:304357 81/309 (26%)
TyrKc 712..996 CDD:197581 77/293 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.