DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets1 and Ets97D

DIOPT Version :9

Sequence 1:XP_017450940.1 Gene:Ets1 / 24356 RGDID:2583 Length:529 Species:Rattus norvegicus
Sequence 2:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster


Alignment Length:474 Identity:130/474 - (27%)
Similarity:193/474 - (40%) Gaps:160/474 - (33%)


- Green bases have known domain annotations that are detailed below.


  Rat    56 SSPYSASHPAIARQGPINSFEDPRMTCGFQSSYHQQRPLYPLWDETATQEVPTGLEHCGSDMECA 120
            |.|.:||..:.:.:.||.:                  ||..:..|.:.:|          .:|..
  Fly   139 SPPETASQKSSSSESPIKT------------------PLKRMHKEDSEEE----------SVEGK 175

  Rat   121 DVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQK 185
            ||       |.:::..|.   |.|.:||.||.||:...:||..||..|:.|||.:|.|.|::...
  Fly   176 DV-------KPVLNWVLD---SKFKREQIRLKIPEAANEWTHAHVTYWLEWAVKQFELVGINMSD 230

  Rat   186 FCMNGAALCALGKECFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPTYPESRYTSDYFISY 250
            :.|||..|||:..|.|.:..|...|:|.|.||::|:       :.|.|:..:..:.         
  Fly   231 WQMNGQELCAMTHEEFNQKLPRDPGNIFWTHLQLLK-------ECNFVSVVHKRAE--------- 279

  Rat   251 GIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQTDYFAIK 315
              |..:...|...|..|..|.|..:|                                    :::
  Fly   280 --EQRKPKQPRIMSANSISTNSGGSL------------------------------------SLE 306

  Rat   316 QEVLTPDNMCMGRASRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYP 380
            |.::                 :.|::|::|.||.:..|.| .:.|::.::               
  Fly   307 QRIM-----------------RKSYQSVKSSDSVESTTSS-MNPSNYTTI--------------- 338

  Rat   381 AALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWT 445
                                               |...:|.:||||||||:|||......|.|.
  Fly   339 -----------------------------------GSGNNGQVQLWQFLLEILTDCEHTDVIEWV 368

  Rat   446 GDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLL 510
            |...||||:|||.|||.||::||||.||||||||.||||||.::|.|.:|||:.|:|.|||:.|:
  Fly   369 GTEGEFKLTDPDRVARLWGEKKNKPAMNYEKLSRALRYYYDGDMISKVSGKRFAYKFDCDLKLLI 433

  Rat   511 GYTPEELHAMLDVKPDADE 529
            ||...||..::.....|.|
  Fly   434 GYDANELSTLVSEGKTAPE 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets1XP_017450940.1 None
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:288472
SAM_PNT-GABP-alpha 184..272 CDD:176084 36/97 (37%)
ETS 345..429 CDD:197710 52/83 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D243757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.