DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ets1 and Ets65A

DIOPT Version :9

Sequence 1:XP_017450940.1 Gene:Ets1 / 24356 RGDID:2583 Length:529 Species:Rattus norvegicus
Sequence 2:NP_001303373.1 Gene:Ets65A / 38700 FlyBaseID:FBgn0005658 Length:728 Species:Drosophila melanogaster


Alignment Length:190 Identity:85/190 - (44%)
Similarity:101/190 - (53%) Gaps:34/190 - (17%)


- Green bases have known domain annotations that are detailed below.


  Rat   327 GRASRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGT 391
            |.||....||...:.|.:|         ||.|.||..|    ..|.|      .|....|.|   
  Fly   247 GGASASGGGGSALYSSYKS---------SWGSHSSTQS----QGYSS------NALGIKHDP--- 289

  Rat   392 FKDYVRDRADLNKDKPVI---PAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKL 453
                   .:.|.:..|..   |.::....:|||.|||||||||||:|.:..|.|:|.|...||||
  Fly   290 -------HSQLRQPDPYQMFGPTSSRLASSGSGQIQLWQFLLELLSDSNNASCITWEGTNGEFKL 347

  Rat   454 SDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYT 513
            :||||||||||:||:||.|||:||||.|||||||||:.|..||||.|:|  |.|.|...|
  Fly   348 TDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF--DFQGLAAAT 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ets1XP_017450940.1 None
Ets65ANP_001303373.1 ETS 316..401 CDD:197710 59/86 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.