DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ednra and CCHa1-R

DIOPT Version :9

Sequence 1:NP_036682.1 Gene:Ednra / 24326 RGDID:2535 Length:426 Species:Rattus norvegicus
Sequence 2:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster


Alignment Length:437 Identity:122/437 - (27%)
Similarity:194/437 - (44%) Gaps:96/437 - (21%)


- Green bases have known domain annotations that are detailed below.


  Rat    29 NLSSHVEDFTPFP------GTEFDFLGTTLRPPNLALPSNGSMHGYCPQQTKITTAFKYINTVIS 87
            :|:..|...|.:|      ...|..|.||..|             |.|...:..|   ||..::.
  Fly    40 DLAMVVSQSTQWPLLDTGSSENFSELVTTETP-------------YVPYGRRPET---YIVPILF 88

  Rat    88 CTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHND 152
            ..||:||::||.||:.:....:.|||.||..|.||||.||:.::..:|:.........||     
  Fly    89 ALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYTVEYWP----- 148

  Rat   153 FGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSR---VQGIG-----IPLITAIEIVSI 209
            :|.|||.|..|::..|:|::|..|.|||.|||.|:....|   ..|.|     :.|.||   |||
  Fly   149 YGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATA---VSI 210

  Rat   210 WILSFILAIPEAIGFVMVPFEYKGEQHRTCMLNATTKFMEFYQDVKDWWL----------FGFYF 264
            |:|:.:..:|..||..:   ::.|...::.::        .|...::|.:          |..|:
  Fly   211 WLLAILCGLPALIGSNL---KHLGINEKSIVI--------CYPYPEEWGINYAKSMVLLHFLVYY 264

  Rat   265 CMPLVCTAIFYTLMTCEMLNRRN--GSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRI 327
            .:|||..|:||.|:...::...:  |.::.|:.: ::.||:||.||...||||.:|:.|.|:..:
  Fly   265 AIPLVVIAVFYVLIALHLMYSASVPGEIQGAVRQ-VRARRKVAVTVLAFVVIFGICFLPYHVFFL 328

  Rat   328 ---LKKTVYDEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCC--- 386
               ...|..|:.:       :|..::..:...::..|||.||:||||||..|:..|...|.|   
  Fly   329 WFYFWPTAQDDYN-------AFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKHFNRYLFCRGA 386

  Rat   387 -------------CCHQSKSLMTSVPMNGTSIQWKNQEQNHNTERSS 420
                         |.|:..||        ||...|..:..|:..:|:
  Fly   387 SGRRKKRGQHDTFCMHRDTSL--------TSTASKRFQSRHSCYQST 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EdnraNP_036682.1 7tm_1 97..367 CDD:278431 84/292 (29%)
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 40/104 (38%)
7tm_1 98..364 CDD:278431 84/292 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.