DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4b1 and Cyp6a22

DIOPT Version :9

Sequence 1:NP_058695.2 Gene:Cyp4b1 / 24307 RGDID:2480 Length:511 Species:Rattus norvegicus
Sequence 2:NP_001286431.1 Gene:Cyp6a22 / 49847 FlyBaseID:FBgn0013773 Length:499 Species:Drosophila melanogaster


Alignment Length:478 Identity:118/478 - (24%)
Similarity:201/478 - (42%) Gaps:105/478 - (21%)


- Green bases have known domain annotations that are detailed below.


  Rat    88 FVGFLNIYEP----------------DYA----KAVY--SRGDPKAADVYDFFLQWIGKGLLVLD 130
            |.||..:..|                |:|    :.:|  .|.||....::.            :|
  Fly    70 FAGFFMMLRPVVLVTDLELAKQILIQDFANFEDRGMYHNERDDPLTGHLFR------------ID 122

  Rat   131 GPKWFQHRKLLTPGFHYDVLK---PYVAIFAESTRMMLDKWEKKASENKSFDIFCDVGHM----A 188
            ||||...|:.::|.|....:|   |.|....|....:..    :.::|....|. ::|.:    .
  Fly   123 GPKWRPLRQKMSPTFTSAKMKYMFPTVCEVGEELTQVCG----ELADNAMCGIL-EIGDLMARYT 182

  Rat   189 LDTLMKCTFGKGDSGLGHRDNSYYLAVSDLTLLMQQR--------IDSFQYHNDFIYWLTPHGRR 245
            .|.:.:|.||...:||  |:.....|:.......::|        |:||           |...|
  Fly   183 SDVIGRCAFGVECNGL--RNPEAEFAIMGRRAFSERRHCKLVDGFIESF-----------PEVAR 234

  Rat   246 FLRACKIAHDHTD-------EVIRQRKAALQDEKERKKIQQRRHLDFLDILLGVRDESGIKLSDA 303
            |||..:|..|.||       |.::||        |.:.|.:.   ||:::|:.::...  :|:..
  Fly   235 FLRMRQIHQDITDFYVGIVRETVKQR--------EEQGIVRS---DFMNLLIEMKQRG--ELTIE 286

  Rat   304 ELRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQQLCREEVRGILGDQ------DSFQWDDLAK 362
            |:.|:...|...|.||:.|.:.:.||.:|..|..|...|||:     ||      ..|.:|.:.:
  Fly   287 EMAAQAFIFFAAGFDTSASTLGFALYELAKQPALQAKLREEI-----DQALRLHNGEFTYDSMQE 346

  Rat   363 MTYLTMCMKECFRLYPPVPQVYRQLNKPVTFVDGRS---LPAGSLISLHIYALHRNSTVWPDPEV 424
            :.|:.:.:.|..|.||.:||:.| :::.:....|..   :..|.::.:.:|.:|.:..::|:|..
  Fly   347 LRYMELVIAETLRKYPILPQLTR-ISRHLYAAKGDRHFYIEPGQMLLIPVYGIHHDPALYPEPHK 410

  Rat   425 FDPLRFSPENAAGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSLDP---SKMPIK 486
            |.|.||..:..|.|...|::||..|||||||.:|...:..:.....|..|.||:.|   .|:...
  Fly   411 FIPERFLADQLAQRPTAAWLPFGDGPRNCIGMRFGKMQTTIGLVSLLRNFHFSVCPRTDPKIEFL 475

  Rat   487 VPQLILRSKNGIHLYLKPLASRS 509
            ...::|...|||:|.::.|:..|
  Fly   476 KSNILLCPANGIYLKVQQLSQMS 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 115/467 (25%)
Cyp6a22NP_001286431.1 p450 35..491 CDD:278495 116/469 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.