DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4b1 and Cyp9c1

DIOPT Version :9

Sequence 1:NP_058695.2 Gene:Cyp4b1 / 24307 RGDID:2480 Length:511 Species:Rattus norvegicus
Sequence 2:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster


Alignment Length:464 Identity:104/464 - (22%)
Similarity:184/464 - (39%) Gaps:74/464 - (15%)


- Green bases have known domain annotations that are detailed below.


  Rat    90 GFLNIYEPDYAKAVYSRGDPK-----AADVYDFFLQW-------------IGKGLLVLDGPKWFQ 136
            |..|:.:|     :|...||:     ....:|.|...             |.|.||.|...:|.|
  Fly    74 GVFNLRDP-----LYYLSDPELIRQVGIKNFDTFTNHRKGITEGFNDTSVISKSLLSLRDRRWKQ 133

  Rat   137 HRKLLTPGFHYDVLKPYVAIF----AESTRMMLDKWEKKASENKSFDIFCDVGHMALDTLMKCTF 197
            .|..|||.|....::....:.    .|:...:..:.:...||.:..|.|.   ....|.:....|
  Fly   134 MRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQLDAGTSELELKDFFT---RYTNDVIATAAF 195

  Rat   198 GKGDSGLGHRDNSYYLAVSDLTLLMQQRIDSFQYHND---FIYWLTPHGRRFLRACKIAHDHTDE 259
            |...:.....:|.::        .:.|||..|.:...   .:|.|.|...:.||...:..::.|.
  Fly   196 GIQVNSFKDPNNEFF--------SIGQRISEFTFWGGLKVMLYILMPKLMKALRVPVMDMNNVDY 252

  Rat   260 VIRQRKAALQDEKERKKIQQRRHLDFLDILLGVR-----DESG----------IKLSDAELRAEV 309
            ..:....|::..||:..::.    |.:.:|:..:     ::.|          .:.:|.:|.|:.
  Fly   253 FKKLVFGAMKYRKEQSIVRP----DMIHLLMEAQRQFKAEQEGSAESAAQQDKAEFNDDDLLAQC 313

  Rat   310 DTFMFEGHDTTTSGISWFLYCMALYPEHQQLCREEVRGI---LGDQDSFQWDDLAKMTYLTMCMK 371
            ..|...|.:|..:.:|:..|.:.:.||.|:....|:..:   ||:: ...:|.|..|.||...:.
  Fly   314 LLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQLGEK-PLDYDTLMGMKYLNCVVS 377

  Rat   372 ECFRLYPPVPQVYRQLNKPVTFVDGR-----SLPAGSLISLHIYALHRNSTVWPDPEVFDPLRFS 431
            |..|.:||...|.|.........|..     :|....|:.:::.|||.:...:|:||.|.|.||.
  Fly   378 ESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDLVHINVGALHHDPDNFPEPEQFRPERFD 442

  Rat   432 PENAAGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSLDPSKMPIKVPQLILRSKN 496
            .|:......|.::||..|.|:|||.:.|:.|:|.:....:||:.  |.|:.   :.|..::.|.:
  Fly   443 EEHKHEIRQFTYLPFGVGQRSCIGNRLALMEVKSLIFQLVLRYH--LKPTD---RTPADMMSSIS 502

  Rat   497 GIHLYLKPL 505
            |..|..:.|
  Fly   503 GFRLLPREL 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 102/457 (22%)
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 104/464 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.