DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4b1 and Cyp6a21

DIOPT Version :9

Sequence 1:NP_058695.2 Gene:Cyp4b1 / 24307 RGDID:2480 Length:511 Species:Rattus norvegicus
Sequence 2:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster


Alignment Length:532 Identity:120/532 - (22%)
Similarity:217/532 - (40%) Gaps:90/532 - (16%)


- Green bases have known domain annotations that are detailed below.


  Rat    21 ILMVIVLKLFSLLLR--RQKLARAMD-SFPGPPTHWLFGHALEIQKLGSLDKV-VSWAQQF---- 77
            :|:..:|.|...||.  |..:....| ..|....|.|.|....::...|.::: .|:..:|    
  Fly     6 VLLTALLALVGYLLMKWRSTMRHWQDLGIPCEEPHILMGSMKGVRTARSFNEIWTSYYNKFRGSG 70

  Rat    78 PHAHPLWFGQFVGFLNIYEPDYAKAVY--------SRG-------DPKAADVYDFFLQWIGKGLL 127
            |.|...||.:...|  :.|...||.:.        .||       ||.:..            |.
  Fly    71 PFAGFYWFRRPAVF--VLETSLAKQILIKEFNKFTDRGFFHNPEDDPLSGQ------------LF 121

  Rat   128 VLDGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTRMMLDKWEKKASENKSFDIFCDVGHMALDTL 192
            :|||.||...|..|:..|....:|.......:......|.:.:..:::...::...:.....|.:
  Fly   122 LLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAKSPVVEVRELLARFTTDVI 186

  Rat   193 MKCTFGKGDSGLGHRDNSY-YLAVSDLTLLMQQR--------IDSF-----QYHNDFIYWLTPHG 243
            ..|.||...|.|...|..: .:....||   :||        ::||     :.|....  ..|..
  Fly   187 GTCAFGIECSSLKDPDAEFREMGRRSLT---EQRLGPVGIGFVNSFPNLARRLHMKMT--AEPIE 246

  Rat   244 RRFLRACKIAHDHTDEVIRQRKAALQDEKERKKIQQRRHLDFLDILLGVRD------ESG--IKL 300
            |.|:|           ::|:..|.    :|:..|   |..||:|.|:.:::      :||  :.|
  Fly   247 RFFMR-----------IVRETVAF----REQNNI---RRNDFMDQLIDLKNKPLMVSQSGESVNL 293

  Rat   301 SDAELRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQQLCREEVRGILGD-QDSFQWDDLAKMT 364
            :..|:.|:...|...|.:|:::.:.:.||.:|...:.|...|:|.:.::.. .....::.:..:.
  Fly   294 TIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNRVRKECQEVIEKCNGELNYESMKDLV 358

  Rat   365 YLTMCMKECFRLYPPVPQVYRQLNKPVTFVDGRS---LPAGSLISLHIYALHRNSTVWPDPEVFD 426
            ||...:.|..|||..:|.:.|:..:... |.|..   :..|..:.:...|:||:..::.:|..|:
  Fly   359 YLDQVVSETLRLYTVLPVLNRECLEDYE-VPGHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFN 422

  Rat   427 PLRFSPENAAGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSL-DPSKMPI--KVP 488
            |..||||....|....::||..|||||||.:|...:.::..||.:..|:||: :.:.:|:  ...
  Fly   423 PDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIGLALLIKDFKFSVCEKTTIPMTYNKE 487

  Rat   489 QLILRSKNGIHL 500
            ..::.|.:||:|
  Fly   488 MFLIASNSGIYL 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 112/501 (22%)
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 112/501 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.