DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4b1 and Cyp9b2

DIOPT Version :9

Sequence 1:NP_058695.2 Gene:Cyp4b1 / 24307 RGDID:2480 Length:511 Species:Rattus norvegicus
Sequence 2:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster


Alignment Length:423 Identity:104/423 - (24%)
Similarity:174/423 - (41%) Gaps:45/423 - (10%)


- Green bases have known domain annotations that are detailed below.


  Rat    87 QFVGFLNIYEPDYAKAVYSRGDP---KAADVYDF--------FL----QWIGKGLLVLDGPKWFQ 136
            :.|||.|:..|     :.:..||   |...|.||        |:    :.....|.|:...:|..
  Fly    70 KLVGFFNMRTP-----MITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLFNDMLSVMRDQRWKH 129

  Rat   137 HRKLLTPGFHYDVLKPYVAIFAES---TRMMLDKWEKKASENKSFDIFCDV--GHMALDTLMKCT 196
            .|..|||.|....::....:..||   ....||...|.....|.|::...|  ..::.|.:....
  Fly   130 MRNTLTPVFTAAKMRNMFTLMNESFAECLQHLDSSSKTLPGRKGFEVDMKVMCNKLSNDIIATTA 194

  Rat   197 FGKGDSGLGHRDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLTPHGRRFLRACKIAHDHTDEVI 261
            ||...:...:..|.:|  ....:|:..:.:..|::   .:..|.|.....|:.........|...
  Fly   195 FGLKVNSYDNPKNEFY--EIGQSLVFSRGLQFFKF---MLSTLVPKLFSLLKLTIFDSAKVDYFA 254

  Rat   262 RQRKAALQDEKERKKIQQRRHLDFLDILLGVRDESGIKLSDAELRAEVDTFMFEGHDTTTSGISW 326
            |....|:| .:|:..|.:.   |.:.:|:..::||..|.:|.|:.|:...|.|...:..::.|..
  Fly   255 RLVVEAMQ-YREKHNITRP---DMIQLLMEAKNESEDKWTDDEIVAQCFIFFFAAFENNSNLICT 315

  Rat   327 FLYCMALYPEHQQLCREEV----RGILGDQDSFQWDDLAKMTYLTMCMKECFRLYPPVPQVYRQL 387
            ..|.:...|:.|:...||:    :.:.|  ....:|.:.||||:.|.:.|..|.:.......|..
  Fly   316 TTYELLYNPDVQERLYEEIVETKKALNG--APLTYDAVQKMTYMDMVISESLRKWTLAAATDRLC 378

  Rat   388 NKPVTFV--DGRSL---PAGSLISLHIYALHRNSTVWPDPEVFDPLRFSPENAAGRHPFAFMPFS 447
            :|..|..  ||..|   ..|..|::.|..||.:...:|:|..|||.|||.|......|:.::||.
  Fly   379 SKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPDRFSEERKGDMVPYTYLPFG 443

  Rat   448 AGPRNCIGQQFAMNEMKVVTALCLLRFEFSLDP 480
            .|||||||.::|:.::|.:....||.::....|
  Fly   444 VGPRNCIGNRYALMQVKGMLFNLLLHYKIEASP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 104/423 (25%)
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 104/423 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.