DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4b1 and Cyp9b1

DIOPT Version :9

Sequence 1:NP_058695.2 Gene:Cyp4b1 / 24307 RGDID:2480 Length:511 Species:Rattus norvegicus
Sequence 2:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster


Alignment Length:499 Identity:111/499 - (22%)
Similarity:191/499 - (38%) Gaps:68/499 - (13%)


- Green bases have known domain annotations that are detailed below.


  Rat    20 VILMVIVLKLFSLLLRRQKLARAMDSFPGPPTHWLFGHALEIQKLGSLDKVVSWAQQFPHAHPLW 84
            ::|..|.|.||.......|.....:.:...|..:|...|....:..|..|.:|........|.| 
  Fly     8 LVLATIGLLLFKWSTGTFKAFEGRNLYFEKPYPFLGNMAASALQKASFQKQISEFYNRTRHHKL- 71

  Rat    85 FGQFVGFLNIYEPDYAKAVYSRGDP---KAADVYDF------------FLQWIGKGLLVLDGPKW 134
                ||..|:..|     :....||   |...|.||            ..:.:...|.|:....|
  Fly    72 ----VGLFNLRTP-----MIQINDPQLIKKICVKDFDHFPNHQTLNIPNERLVNDMLNVMRDQHW 127

  Rat   135 FQHRKLLTPGFHYDVLKPYVAIFAESTRMMLDKWEKK----ASENKSFD----IFCDVGHMALDT 191
            ...|.:|||.|....::....:..||....|:..:..    |.|| :|:    :.|:  .::.|.
  Fly   128 RNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGEN-AFELDMKVLCN--KLSNDV 189

  Rat   192 LMKCTFGKGDSGLGHRDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLTPHGRRFLRACKIAHDH 256
            :....||...:.....:|.::  ....||...:.:...::   .:..|.|....|.:.......:
  Fly   190 IATTAFGLKVNSFDDPENEFH--TIGKTLAFSRGLPFLKF---MMCLLAPKVFNFFKLTIFDSTN 249

  Rat   257 TDEVIRQRKAALQDEKERKKIQQRRHLDFLDILLGVRDESGIKLSDAELRAEVDTFMFEGHDTTT 321
            .:..:|....|:| .:|:..|.:.   |.:.:|:..:.||....:|.|:.|:...|.|...:..:
  Fly   250 VEYFVRLVVDAMQ-YREKHNITRP---DMIQLLMEAKKESKDNWTDDEIVAQCFIFFFAAFENNS 310

  Rat   322 SGISWFLYCMALYP-----EHQQLCREEVRGILGDQDSFQ-----WDDLAKMTYLTMCMKECFRL 376
            :     |.|...|.     :.|:...|||:   ..|::.:     :|...:|||:.|.:.|..|.
  Fly   311 N-----LICTTAYELLRNLDIQERLYEEVK---ETQEALKGAPLTYDAAQEMTYMDMVISESLRK 367

  Rat   377 YPPVPQVYRQLNKPVTFVD--GRSL---PAGSLISLHIYALHRNSTVWPDPEVFDPLRFSPENAA 436
            :.......|...|..|..|  |..|   .||..|::.|..||.:...:|.|:.|||.|||.....
  Fly   368 WTLSAAADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDPERFSERRKK 432

  Rat   437 GRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSLDP 480
            ...|:.::||..|||:|||.::|:.:.|.:....:|.::....|
  Fly   433 DLIPYTYLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKIEASP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 105/472 (22%)
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 105/470 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.