DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4b1 and Cyp4ac3

DIOPT Version :9

Sequence 1:NP_058695.2 Gene:Cyp4b1 / 24307 RGDID:2480 Length:511 Species:Rattus norvegicus
Sequence 2:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster


Alignment Length:522 Identity:149/522 - (28%)
Similarity:255/522 - (48%) Gaps:50/522 - (9%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MVLNFLSPSLSRLGLWASVVILMVIVLKLFSLLLRRQKLARAMDSFP------GPPTHWLFGHAL 59
            |.:..|..||....||     |::..|.....:|...|..|..|..|      ..|....||:.|
  Fly     1 MWIALLGSSLLIGALW-----LLLRQLNKTYFILSLCKRVRTADGSPLESKVFVVPGKTRFGNNL 60

  Rat    60 EIQKLGSLDKVVSWAQQFP----HAHPLWFGQFVGFLNIYEPDYAKAVYSRGDPKAADV-YDFFL 119
            ::..|...: :.|:.::..    ..:.:|...|....||...:.|:.::........:: |:...
  Fly    61 DLLNLTPAN-IFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKNMSYELIR 124

  Rat   120 QWIGKGLLVLDGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTRMMLDKWEKKASENKSFDIFCD- 183
            .::|.|||:....||...||.|||.||:::|:.:::||.|.::    |:.|...:|..|::..: 
  Fly   125 PFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESK----KFIKILDKNVGFELELNQ 185

  Rat   184 -VGHMALDTLMKCTFG--KGDSGLGHRDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLTPHGRR 245
             :....|:.:.:...|  ..|...|   |.|..|:.|..::..||:.:.....::.::|....::
  Fly   186 IIPQFTLNNICETALGVKLDDMSEG---NEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKK 247

  Rat   246 FLRACKIAHDHTDEVIRQRKAALQDEKERKKIQQ---RRHLDFLDILLGVRDESGIKLSDAELRA 307
            :.|..:..|..:..:| |||.....:|:..::.:   ::....||.||....|.  |:....:..
  Fly   248 YSRILRTIHGFSSGII-QRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEG--KIDHQGICD 309

  Rat   308 EVDTFMFEGHDTTTSGISWFLYCMALYPEHQQLCREEVRGILGDQDS---FQWDDLAKMTYLTMC 369
            ||:||||.|:|||::.:.:.|..:||:.:.|:.|.||::.:..|.|.   ||:::|   .:|...
  Fly   310 EVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNEL---IHLECV 371

  Rat   370 MKECFRLYPPVPQVYRQLNKPVTFVDGRSLPAGSLISLHIYALHRNSTVWPDPEVFDPLRFSPEN 434
            :||..||:|..|.:.|...:. :.::|..||..:.||:|||.:.|::..:|.|..|.|.||.|||
  Fly   372 IKESLRLFPSAPIIGRTCIEE-SVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPEN 435

  Rat   435 AAGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSLDPSKMPIKVPQL-ILRSKNGI 498
            :..||||||:||||||||||||:|.:.|:||:.|..:..|:.        :...|| .|..:|||
  Fly   436 SVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKL--------LPATQLEDLTFENGI 492

  Rat   499 HL 500
            .|
  Fly   493 VL 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 136/474 (29%)
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 136/467 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348755
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.