DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4b1 and Cyp4ac2

DIOPT Version :9

Sequence 1:NP_058695.2 Gene:Cyp4b1 / 24307 RGDID:2480 Length:511 Species:Rattus norvegicus
Sequence 2:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster


Alignment Length:443 Identity:133/443 - (30%)
Similarity:235/443 - (53%) Gaps:48/443 - (10%)


- Green bases have known domain annotations that are detailed below.


  Rat    83 LWFGQFVGFLNIYEPDYAKAVYSRGDPKAAD-VYDFFLQWIGKGLLVLDGPKWFQHRKLLTPGFH 146
            ||:.......||...:.|:.:.........: :|:....::|:|||:....||...||.|||.||
  Fly    88 LWYFFHAPMYNIVRAEEAEEILQSSKLITKNMIYELLKPFLGEGLLISTDQKWHSRRKALTPAFH 152

  Rat   147 YDVLKPYVAIFAESTRMMLDKWEKKASENKSFDIFCDVGHMALDTLMKCTFG-KGD---SGLGHR 207
            :.||:.::.||.|....::....:  |.|...::...:....|:.:.:...| |.|   .|:.:|
  Fly   153 FKVLQSFLIIFKEECNKLVKVLHQ--SVNMELELNQVIPQFTLNNVCETALGVKLDDLSEGIRYR 215

  Rat   208 DNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLTPHGRRFLRACKIAHDHTDEVIRQRKAALQDEK 272
            .:.:  |:.:   :||||:.:..::|...::|....|:.:...||||:.:..:|.:|::..:..:
  Fly   216 QSIH--AIEE---VMQQRLCNPFFYNIVYFFLFGDYRKQVNNLKIAHEFSSNIIEKRRSLFKSNQ 275

  Rat   273 --ERKKIQQRRHLDFLDILL-----GVRDESGIKLSDAELRAEVDTFMFEGHDTTTSGISWFLYC 330
              :..:..:::....||.||     |..|..||  .|     ||:||||||:|||::.:.:.|..
  Fly   276 LGQEDEFGKKQRYAMLDTLLAAEADGQIDHQGI--CD-----EVNTFMFEGYDTTSTCLIFTLLM 333

  Rat   331 MALYPEHQQLCREEVRGILGDQDS---FQWDDLAKMTYLTMCMKECFRLYPPVPQVYRQ-LNKPV 391
            :||:.:.|:.|.||::.:..|.|.   ||:::|   .|:...:||..||:|.||.:.|: :.:.|
  Fly   334 LALHEDVQKKCYEEIKYLPDDSDDISVFQFNEL---VYMECVIKESLRLFPSVPFIGRRCVEEGV 395

  Rat   392 TFVDGRSLPAGSLISLHIYALHRNSTVWPDPEVFDPLRFSPENAAGRHPFAFMPFSAGPRNCIGQ 456
              |:|..:|..:.|::|:|.:.|::..:.:|::|.|.||.|||...||||||:|||||.||||||
  Fly   396 --VNGLIMPKNTQINIHLYEIMRDARHFSNPKMFQPDRFFPENTVNRHPFAFVPFSAGQRNCIGQ 458

  Rat   457 QFAMNEMKVVTALCLLRFEFSLDPSKMPIKVPQ-------LILRSKNGIHLYL 502
            :||:.|:||:.|..:..|:.      :|:.:..       ::||:|..|.:.|
  Fly   459 KFAILEIKVLLAAVIRNFKI------LPVTLLDDLTFENGIVLRTKQNIKVKL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 132/439 (30%)
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 132/441 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348754
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.