DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4a2 and Cyp4ac3

DIOPT Version :9

Sequence 1:XP_038965182.1 Gene:Cyp4a2 / 24306 RGDID:2479 Length:517 Species:Rattus norvegicus
Sequence 2:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster


Alignment Length:473 Identity:136/473 - (28%)
Similarity:230/473 - (48%) Gaps:78/473 - (16%)


- Green bases have known domain annotations that are detailed below.


  Rat    80 PGACLQWLSGSTARV--------LLYDPDYVKVVLGRSDPKPYQS------------LAPWIGYG 124
            |.....::..|||:.        .|:.|:| .:|......:.:||            :.|::|.|
  Fly    67 PANIFSYIRESTAKANGQNYIWNFLFAPEY-NIVRAEDAEEIFQSTKITTKNMSYELIRPFLGDG 130

  Rat   125 LLLLNGKKWFQHRRMLTPAFHYDILKPYVKIMADSVSIMLDKWEKLDDQD--HPLEIFHYVSLMT 187
            ||:...:||...|:.||||||::||:.::.|..:...    |:.|:.|::  ..||:...:...|
  Fly   131 LLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESK----KFIKILDKNVGFELELNQIIPQFT 191

  Rat   188 LDTVMKCAFSHQGSVQLDVNS--RSYTKAVEDL---------NNLIFFRVRSAFYGNSIIYNMSS 241
            |:.:.:.|.    .|:||..|  ..|.||:.|.         |.|:||......:|:...|:   
  Fly   192 LNNICETAL----GVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYS--- 249

  Rat   242 DGRLSRRACQIAHEHTGSVFLLPAFLSLSDGVIKTRKAQLQNEE--ELQKARKKRHLDFLDILLF 304
                  |..:..|             ..|.|:|:.::.|.:.::  ::.:..||:....||.||.
  Fly   250 ------RILRTIH-------------GFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLA 295

  Rat   305 AKMEDGKSLSDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPEHQERCREEVQSILGDGTSVT 369
            |:.| || :..:.:..||:||||.|:|||::.:.:....||.|.:.||||.||:|.:..|...|:
  Fly   296 AEAE-GK-IDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVS 358

  Rat   370 WDHLDQMPYTTMCIKEALRLYSPVPSVSRELSSPVTFPDGRSIPKGIRVTILIYGLHHNPSYWPN 434
            ....:::.:....|||:|||:...|.:.|..... :..:|..:||..:::|.||.:..:..::|.
  Fly   359 MFQFNELIHLECVIKESLRLFPSAPIIGRTCIEE-SVMNGLVLPKNAQISIHIYDIMRDARHFPK 422

  Rat   435 PKVFDPSRFSPDSP--RHSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDPTRIPVP 497
            |..|.|.||.|::.  ||..|::|||.|.|||||::|.:.|:||.:|..:..|:||| .|::.  
  Fly   423 PNQFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLP-ATQLE-- 484

  Rat   498 MPRLVLKSKNGIHLRLKK 515
                .|..:|||.||.::
  Fly   485 ----DLTFENGIVLRTQQ 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4a2XP_038965182.1 CYP4B-like 69..512 CDD:410771 134/468 (29%)
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 136/473 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.