DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4a2 and Cyp4g1

DIOPT Version :9

Sequence 1:XP_038965182.1 Gene:Cyp4a2 / 24306 RGDID:2479 Length:517 Species:Rattus norvegicus
Sequence 2:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster


Alignment Length:550 Identity:160/550 - (29%)
Similarity:252/550 - (45%) Gaps:98/550 - (17%)


- Green bases have known domain annotations that are detailed below.


  Rat    29 LVLFKAVQFYLRRQWLLKALEKFPSTPSHWLWGH-----NLKDREFQQV-LTWVEKFPGACLQWL 87
            ||.....:::.|.....:.:...||.|...:.|.     .|.:.|...| |.::.|:......||
  Fly    35 LVAMALYEYWRRNSREYRMVANIPSPPELPILGQAHVAAGLSNAEILAVGLGYLNKYGETMKAWL 99

  Rat    88 SGSTARVLLYDPDYVKVVLG----RSDPKPYQSLAPWIGYGLLLLNGKKWFQHRRMLTPAFHYDI 148
             |:...|.|.:|..::::|.    .:..:.|:...||.|.|||:.||..|..||:|:.|.||..|
  Fly   100 -GNVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKPWFGDGLLISNGHHWRHHRKMIAPTFHQSI 163

  Rat   149 LKPYVKIMAD-SVSIM----LDKWEKLDDQDHPLEIFHYVSLMTLDTVMKCAFSHQGSVQLDVNS 208
            ||.:|....| |.:::    |:..:..|..|       |:|..|:|.::..|   .|..:|...:
  Fly   164 LKSFVPTFVDHSKAVVARMGLEAGKSFDVHD-------YMSQTTVDILLSTA---MGVKKLPEGN 218

  Rat   209 RS--YTKAVEDLNNLIFFRVRSAFYGNSIIYNMSSDGRLSRRACQIAHEHTGSVFLLPAFLSLSD 271
            :|  |.:||.|:.::|..|.....|....||..:.......|...|             .|.::.
  Fly   219 KSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDRMMNI-------------ILGMTS 270

  Rat   272 GVIKTRKAQLQNE-----EELQ------KARKKRHL-DFLD-------------ILLFAKMEDGK 311
            .|:|.||...|.|     ||:.      .|.||..| |.||             .||.|.:|..|
  Fly   271 KVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAK 335

  Rat   312 S----LSDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPEHQERCREEVQSILGDG--TSVTW 370
            :    .:::|:..||:|.||||||||::|.|:....:..|.:.|.:...|.::|.||.  ...|:
  Fly   336 NPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTF 400

  Rat   371 DHLDQMPYTTMCIKEALRLYSPVPSVSRELSSPVTFPDG-RSIPKGIRVTILIYGLHHNPSYWPN 434
            ....:|.|....|.|.||||.|||.::|.|...:....| .::|||..|.:|.|.:|..|..:||
  Fly   401 ADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIYPN 465

  Rat   435 PKVFDPSRFSPD--SPRHSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLR------------F 485
            |..|||..|.|:  :.||.::::|||.|.|:|:|:::||.:|||.:: |::|            |
  Fly   466 PTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLS-TIVRNYIVHSTDTEADF 529

  Rat   486 ELLPDPTRIPVPMPRLVLKSKNGIHLRLKK 515
            :|..|          ::||.:||.::.|:|
  Fly   530 KLQAD----------IILKLENGFNVSLEK 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4a2XP_038965182.1 CYP4B-like 69..512 CDD:410771 149/500 (30%)
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 148/484 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.