DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp21a1 and spo

DIOPT Version :9

Sequence 1:NP_476442.2 Gene:Cyp21a1 / 24298 RGDID:2461 Length:493 Species:Rattus norvegicus
Sequence 2:NP_001286943.1 Gene:spo / 38631 FlyBaseID:FBgn0003486 Length:543 Species:Drosophila melanogaster


Alignment Length:515 Identity:129/515 - (25%)
Similarity:210/515 - (40%) Gaps:124/515 - (24%)


- Green bases have known domain annotations that are detailed below.


  Rat    38 GFLHFLQ--PNLPVYLF-GLAQKLGPIYRIRLGLQDVVVLNSNKTIEEALIQKWVDFAGRP---- 95
            |.||.|.  .:.|...| .|||:.|.||.:..|....:|:|:.:.|.|.|.|.....:|||    
  Fly    65 GNLHLLDRYRDSPFAGFTALAQQYGDIYSLTFGHTRCLVVNNLELIREVLNQNGKVMSGRPDFIR 129

  Rat    96 --QILDGKMNFDLSMGDYSLTWKAHKKLSR-------------------------------SALV 127
              ::..|:.:..|::.|:|...:..:.|:|                               :.||
  Fly   130 YHKLFGGERSNSLALCDWSQLQQKRRNLARRHCSPREFSCFYMKMSQIGCEEMEHWNRELGNQLV 194

  Rat   128 LGMRDSMEPLVEQLTQEFCERMRAQAGASVAIHKEFSLLTCSIISCLTFGDKQDSTLLNATHSCV 192
            .|...:::||:    .:.|..|             ||...||    |.| |..|...        
  Fly   195 PGEPINIKPLI----LKACANM-------------FSQYMCS----LRF-DYDDVDF-------- 229

  Rat   193 RDLLKAWNH--WSV---QILDIIPFLRFFPNPGLWKLKQFQESRDHIVMQELKRHKDSLV--AGQ 250
            :.:::.::.  |.:   ..||.:|:|..|....|.|:..:..:....:|:.:.||::..|  ...
  Fly   230 QQIVQYFDEIFWEINQGHPLDFLPWLYPFYQRHLNKIINWSSTIRGFIMERIIRHRELSVDLDEP 294

  Rat   251 WKDMIDYMLQGVEKQRDARDPGQLHERHVHMSVVDLFVGGTETTAATLSWAVAFLLHHPEIQKRL 315
            .:|..|.:|:.:.:.:|.       .|:..:.:::.|:||.......:...:|::..:.:|.:|:
  Fly   295 DRDFTDALLKSLLEDKDV-------SRNTIIFMLEDFIGGHSAVGNLVMLVLAYIAKNVDIGRRI 352

  Rat   316 QEELDLKLAP---SSQLLYKNRMQLPLLMATIAEVLRL--RPVVPMALPHRATKASSISGYDIPK 375
            |||:|..:..   |..||..|.|  |..||||.||||.  .|:|    ||.||:.:.||||.:.|
  Fly   353 QEEIDAIIEEENRSINLLDMNAM--PYTMATIFEVLRYSSSPIV----PHVATEDTVISGYGVTK 411

  Rat   376 DTIIIPNIQGANLDEMVWELPSKFWPDRFLESGK--SPR---------------------IP--- 414
            .||:..|....|..|..|..|.:|.|.||||..|  ||:                     ||   
  Fly   412 GTIVFINNYVLNTSEKFWVNPKEFNPLRFLEPSKEQSPKNSKGSDSGIESDNEKLQLKRNIPHFL 476

  Rat   415 TFGCGARVCLGEPLARLELFVVLARLLQTFTLLPPPDGTL---PSLQPLPYTGINLLIPP 471
            .|..|.|.|:|:.|.|...|:|:..::|.:.:......|:   |....||.....|::.|
  Fly   477 PFSIGKRTCIGQNLVRGFGFLVVVNVMQRYNISSHNPSTIKISPESLALPADCFPLVLTP 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp21a1NP_476442.2 p450 31..474 CDD:278495 129/515 (25%)
Steroid-binding. /evidence=ECO:0000250 337..353 9/17 (53%)
spoNP_001286943.1 p450 56..540 CDD:299894 129/515 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.