DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp11b2 and Cyp12a4

DIOPT Version :9

Sequence 1:NP_036670.2 Gene:Cyp11b2 / 24294 RGDID:2454 Length:502 Species:Rattus norvegicus
Sequence 2:NP_650783.2 Gene:Cyp12a4 / 42294 FlyBaseID:FBgn0038681 Length:536 Species:Drosophila melanogaster


Alignment Length:511 Identity:138/511 - (27%)
Similarity:234/511 - (45%) Gaps:76/511 - (14%)


- Green bases have known domain annotations that are detailed below.


  Rat    38 KPFEAIPQYSRNKWLKMIQILREQGQ-ENLHL-EMHQAF-QELGPIFRHSA--GGAQIVSVMLPE 97
            ||||.||:.  |.|...:::....|: :|:.| ||.:|. |:.|.||....  |....:|...|:
  Fly    45 KPFEQIPRL--NMWALSMKMSMPGGKYKNMELMEMFEAMRQDYGDIFFMPGIMGNPPFLSTHNPQ 107

  Rat    98 DAEKLHQVESILPRRMHLEPWVAHRE------LRGLRRGVFLLNGADWRFNRLKLNPNVLSPKAV 156
            |.|.:.:.|.:.|.|......:.|||      .:|: .||....|..|...|..:||.::.||.|
  Fly   108 DFEVVFRNEGVWPNRPGNYTLLYHREEYRKDFYQGV-MGVIPTQGKPWGDFRTVVNPVLMQPKNV 171

  Rat   157 QNFVPMVDEVARDFLEALKKKVRQNARGSLTMDVQQSLFNYTIEASNFALFGERLGLL-GHDLNP 220
            :.:...:.:|.::|::.: .::|.........|...::..:|:|:.:.....::|||| ..:...
  Fly   172 RLYYKKMSQVNQEFVQRI-LELRDPDTLEAPDDFIDTINRWTLESVSVVALDKQLGLLKNSNKES 235

  Rat   221 GSLKFIHALHSMFKSTTQLLFLPRSLTRWTSTRVWKEHFDAWDVISE----YANRCIWKVHQELR 281
            .:||..|.|...|..:..|...| |..|:..|...|....|.|.|.|    |.:..|.::.:|.:
  Fly   236 EALKLFHYLDEFFIVSIDLEMKP-SPWRYIKTPKLKRLMRALDGIQEVTLAYVDEAIERLDKEAK 299

  Rat   282 LGSSQTYSGIV----AALITQGALPLDAIKAN--SMELTAGSVDTTAIPLVMTLFELARNPDVQQ 340
                   .|:|    ...:.:..|.:|...|.  :|::....||||:......|..||:||:.|.
  Fly   300 -------EGVVRPENEQSVLEKLLKVDRKVATVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQA 357

  Rat   341 ALRQETLAAEASIAAN-----PQKAMSDLPLLRAALKETLRLYP--VGGFLERILNSDLVLQNYH 398
            .||:|.:    .:..|     .:.:|.::|.|||.:||:.||:|  ||.  .|:|..|.||..|.
  Fly   358 RLREEVM----KVLPNKNSEFTEASMKNVPYLRACIKESQRLHPLIVGN--ARVLARDAVLSGYR 416

  Rat   399 VPAGTLV-LLYLYSMGRNPAVFPRPERYMPQRWLERKRS---------------FQHLAFGFGVR 447
            |||||.| ::.|.::.|: ..||:...::|:|||...:.               |..|.||||.|
  Fly   417 VPAGTYVNIVPLNALTRD-EYFPQASEFLPERWLRSPKDSESKCPANELKSTNPFVFLPFGFGPR 480

  Rat   448 QCLGRRLAEVEMLLLLHHMLKTFQVE------------TLRQEDVQMAYRFVLMPS 491
            .|:|:|:.|:|:.|....:::.|.||            .:...::.:.::|:.:|:
  Fly   481 MCVGKRIVEMELELGTARLIRNFNVEFNYPTENAFRSALINLPNIPLKFKFIDLPN 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp11b2NP_036670.2 p450 44..498 CDD:278495 133/505 (26%)
Cyp12a4NP_650783.2 p450 72..531 CDD:299894 126/475 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.