DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpb1 and CG8539

DIOPT Version :9

Sequence 1:NP_036665.2 Gene:Cpb1 / 24271 RGDID:2391 Length:415 Species:Rattus norvegicus
Sequence 2:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster


Alignment Length:332 Identity:99/332 - (29%)
Similarity:160/332 - (48%) Gaps:22/332 - (6%)


- Green bases have known domain annotations that are detailed below.


  Rat    90 VLISNVRNAL-ESQFDSHTRASGHSYTKYNKWETIEAWIQQVATDNPDLVTQSVIGTTFEGR--N 151
            ||::.|.|.| |::.....|........|..::.|..::.::|..:.:.||...:..|:|.|  .
  Fly    10 VLVTIVVNQLSEAREVRRRRGLMLQLDNYLSYDGIMQYLDELALSHSNRVTLKDVARTYENRALK 74

  Rat   152 MYVLKIGKTRPNKPAIFIDCGFHAREWISPAFCQWFVREAVRTYNQEIHMKQLLDELDFYVLPVV 216
            |.::..|..||.|..||:|...|:|||::||.....:.:.|..:.:.   ..||.:.|::::|:.
  Fly    75 MAIITNGDGRPGKRVIFLDAALHSREWMTPAAALLTIHKLVVEFAEN---SDLLTDYDWHIMPLA 136

  Rat   217 NIDGYVYTWTKDRMWRKTRSTMAGSSCLGVDPNRNFNAGWCEVG--ASRSPCSETYCGPAPESEK 279
            |.|||.|:...:|.||.|| |..|.:|.|.:.||||...| .||  ..:.||.|.|.|.:|.||.
  Fly   137 NPDGYEYSRNTERYWRNTR-TPNGGNCFGTNLNRNFAVDW-NVGFPELKDPCDENYAGSSPFSEV 199

  Rat   280 ETKALADFIRNNLSTIKA--YLTIHSYSQMMLYPYSYDYKLPENYEELNALVKGAAKELATLHGT 342
            |.:.:.|.:...:.:.:|  ||::|:.::.:.||:.||.....|.:|.:.:.:..|..:....||
  Fly   200 EARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPWVYDTDPVSNQKEHDEIGRFVADRILQSTGT 264

  Rat   343 ---KYTYGPGATTIYPAAGGSDDWSYDQGIKYSFTFELRDTG----FFGFLLPESQIRQTCEETM 400
               .:.|...|.|.   .|.|.|::...|...||.||:..||    .:.|..|...||...||:.
  Fly   265 FIKTWQYAKYAGTF---GGTSMDYALLAGFPLSFVFEMSGTGRDHVEYKFFPPARDIRHLAEESW 326

  Rat   401 LAVKYIA 407
            ..:|..|
  Fly   327 TGIKAFA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpb1NP_036665.2 Propep_M14 33..102 CDD:396700 6/12 (50%)
M14_CPB 112..410 CDD:349443 92/309 (30%)
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 92/304 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351637
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.