DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpb1 and CG8562

DIOPT Version :9

Sequence 1:NP_036665.2 Gene:Cpb1 / 24271 RGDID:2391 Length:415 Species:Rattus norvegicus
Sequence 2:NP_648118.1 Gene:CG8562 / 38828 FlyBaseID:FBgn0035779 Length:424 Species:Drosophila melanogaster


Alignment Length:426 Identity:147/426 - (34%)
Similarity:219/426 - (51%) Gaps:27/426 - (6%)


- Green bases have known domain annotations that are detailed below.


  Rat     4 LLALVSVALAHASEEHFDGNRVYRVSVHGEDHVNLIQELANTKEIDFWKPDSATQV--KPLTTVD 66
            ||.|...|...|:|:.::|.|:|.|.....|..:|:.:| :.:..||   .|.|::  .|...: 
  Fly     7 LLVLFLGATLVAAEQDYEGYRIYEVIPSTADQADLLHQL-SLQGYDF---ISETRLLGHPSRVI- 66

  Rat    67 FHVKAEDVADVENFLEENEVHYEVLISNVRNALESQFDSH---------TRASGHSYTKYNKWET 122
              |....:...:..:|..::...::.||:..::..:|...         |.....|..:|...|.
  Fly    67 --VSPAQLKHFQQLVEAEKMTLTLVNSNLGASIAEEFAQRQMQRLLAPITGKGRLSTERYYTHEE 129

  Rat   123 IEAWIQQVATDNPDLVTQSVIGTTFEGRNMYVLKI--GKTRPNKPAIFIDCGFHAREWISPAFCQ 185
            |..:|..:|...|..|....:|.::|.|.:..:.|  |..:.||..||:|.|||||||||||...
  Fly   130 IINYIDDLAQRFPSRVFVKTVGWSYEQRVLKTITITNGDGKANKKVIFMDGGFHAREWISPAAVL 194

  Rat   186 WFVREAVRTYNQEIHMKQLLDELDFYVLPVVNIDGYVYTWTKD--RMWRKTRS--TMAGSSCLGV 246
            :.:.:.|..:.:..|   ||.:.|:.:||:||.|||.:|.|..  |||||||.  |.||.:|.|.
  Fly   195 YVIDQLVEQFEENAH---LLKDYDWVILPLVNADGYEHTQTGTLARMWRKTRQPYTYAGQTCYGA 256

  Rat   247 DPNRNFNAGWCEVGASRSPCSETYCGPAPESEKETKALADFIRNNLSTIKAYLTIHSYSQMMLYP 311
            ||||||:..|.|.|||.:||::||.||...||.||..:.|.:.:.......|||:|||...:|||
  Fly   257 DPNRNFDFHWNEEGASSNPCADTYAGPTAFSEPETITVRDLMHSLADRGIMYLTLHSYGNYLLYP 321

  Rat   312 YSYDYKLPENYEELNALVKGAAKELATLHGTKYTYGPGATTIYPAAGGSDDWSYDQGIKYSFTFE 376
            :.:...||||:|:|:|:.:..|:.:....||.||||.....:|.|||.|||:.|..|...|.|.|
  Fly   322 WGWTSDLPENWEDLDAVARTGAEAIENATGTVYTYGSSTNVLYIAAGASDDYGYYAGFNVSITME 386

  Rat   377 LRDTGFFGFLLPESQIRQTCEETMLAVKYIANYVRE 412
            |...|..||..|.::|.:...||.:.::.:|..|.|
  Fly   387 LPGAGSIGFNPPVTRIDEFVTETWIGIRAMAEKVIE 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpb1NP_036665.2 Propep_M14 33..102 CDD:396700 12/70 (17%)
M14_CPB 112..410 CDD:349443 121/303 (40%)
CG8562NP_648118.1 Propep_M14 30..99 CDD:280416 13/75 (17%)
M14_CP_A-B_like 124..420 CDD:199844 120/298 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351635
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100142
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.