DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpb1 and CG8563

DIOPT Version :9

Sequence 1:NP_036665.2 Gene:Cpb1 / 24271 RGDID:2391 Length:415 Species:Rattus norvegicus
Sequence 2:NP_001261515.1 Gene:CG8563 / 38826 FlyBaseID:FBgn0035777 Length:440 Species:Drosophila melanogaster


Alignment Length:449 Identity:129/449 - (28%)
Similarity:209/449 - (46%) Gaps:60/449 - (13%)


- Green bases have known domain annotations that are detailed below.


  Rat     2 LLLLALVSVALAHASEEHFDGNRVYRVSVHGEDHV--NLIQELANTKEIDFW---KPDSATQVKP 61
            |.|:.|..:.:|: :...::|...|.|. ||:::.  .::....|..|:|||   :..|...|.|
  Fly    11 LCLVGLAGLGIAN-NLAGYEGYTKYTVQ-HGDENAFKYMVDLQTNDAELDFWLLTRNSSVLTVSP 73

  Rat    62 LTTVDFHVK-------------AEDVADVE---NFLEEN-EVHYEVLISNVRNALESQFDS---- 105
            .....|...             .|.:|.::   :|.::| :..||          |.|.|.    
  Fly    74 RRKTQFEASLSSLGVSYEMQPLMELMAALQANSSFADDNYDGEYE----------ECQQDECEQA 128

  Rat   106 -----HTRASGHS-YTKYNKWETIEAWIQQVATDNPDLVTQSVIGTTFEGRNMYVLKI---GKTR 161
                 .||..... ::.|.::..:.:::..:|...|.......:|.:.|||::..|.|   .:.|
  Fly   129 ERPRRRTRRQARGFFSHYPRYHEVLSFMSGLAARYPQFCRYESLGRSNEGRHIAALSISLNSRVR 193

  Rat   162 PNKPAIFIDCGFHAREWISPAFCQWFVREAVRTYNQEIHMKQLLDELDFYVLPVVNIDGYVYTWT 226
            |.:.| :|....|.||||:.....:...|.:.....   ..::|.:::.:::|:||.|||.||.|
  Fly   194 PRRVA-YIQAATHGREWITTQTVLYLAYELLSNLRA---FTRVLQDVEIFLVPLVNPDGYEYTHT 254

  Rat   227 KDRMWRKTRSTMAGSSCLGVDPNRNFNAGWCEVGASRSPCSETYCGPAPESEKETKALADFIRNN 291
            .||.|||.|...||.||.|||.||||...|...|||::.|||.|.|.||.||.||.|:..::..|
  Fly   255 TDRFWRKNRHRYAGHSCSGVDINRNFGNHWNYQGASQNLCSEVYSGTAPNSEPETSAVVRYLEFN 319

  Rat   292 LSTIKAYLTIHSYSQMMLYPYSY-DYKLPENYEELNALVKGAAKELATLHGTKYTYGPGATTIYP 355
            .:.:|..|.:||:.:.:.|||.| ...:|.....|.::...||.::....||:||.|..|:.:|.
  Fly   320 RNRVKLSLDVHSFGKFIFYPYGYAKNTVPPTVGTLRSVALRAANQIGRYRGTRYTTGTSASILYE 384

  Rat   356 AAGGSDDWSY-DQGIKYSFTFELRDTGFFGFLLPESQIRQTCEETMLA----VKYIANY 409
            |:|..||::| :.||..|:|.||....|.   :|...|...|:||...    :::::.|
  Fly   385 ASGSLDDFAYGNLGIPLSYTLELPGDEFH---VPAHDIIHVCKETFAGFIEFIRHVSLY 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpb1NP_036665.2 Propep_M14 33..102 CDD:396700 16/90 (18%)
M14_CPB 112..410 CDD:349443 100/308 (32%)
CG8563NP_001261515.1 M14_CP_A-B_like 146..437 CDD:199844 99/297 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.