DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cel and alpha-Est2

DIOPT Version :9

Sequence 1:NP_058693.2 Gene:Cel / 24254 RGDID:2331 Length:612 Species:Rattus norvegicus
Sequence 2:NP_001262345.1 Gene:alpha-Est2 / 40908 FlyBaseID:FBgn0015570 Length:566 Species:Drosophila melanogaster


Alignment Length:505 Identity:152/505 - (30%)
Similarity:227/505 - (44%) Gaps:62/505 - (12%)


- Green bases have known domain annotations that are detailed below.


  Rat    28 TEGGFVEGVNKKLSLLGGDSVDIFKGIPFATAKT----LENPQRHPGWQGTLKATDFKKRCLQAT 88
            |:.|.|.|:.:| ::...:....|:|||:|....    ...||....|||.|..|..:.:.:|..
  Fly    37 TKYGQVRGLQRK-TVYDKEPYFAFEGIPYAKPPVGDLRFRAPQPPEPWQGVLNCTTNRSKPMQRN 100

  Rat    89 ITQDDTYGQEDCLYLNIWVPQGRKQVSHDLPVMVWIYGGAFLMGSGQGANFLKNYLYDGEEIATR 153
            :......|.||||:||::|...:.:  ..|||:||||||.|..|......:..:|.       .:
  Fly   101 MLLGIVEGSEDCLHLNVYVKALKSE--KPLPVIVWIYGGGFQKGEASRDIYSPDYF-------MK 156

  Rat   154 GNVIVVTFNYRVGPLGFLSTGDANL--PGNFGLRDQHMAIAWVKRNIAAFGGDPDNITIFGESAG 216
            ..|:.|..|||:..|||||..|..|  |||.||:||.||:.|:.:|||.|.|||:|||:.|||||
  Fly   157 KPVVFVAINYRLAALGFLSLKDPKLDVPGNAGLKDQVMALRWISQNIAHFNGDPNNITLMGESAG 221

  Rat   217 AASVSLQTLSPYNKGLIRRAISQSGVALSPWAIQENP-LFWAKTIAKKVGCP-TEDTAKMAGCLK 279
            :|||.:...:...:||..:||.|||.|||.|.  |:| ..||..:|:.:|.. .|..|.:...|.
  Fly   222 SASVHVMMTTEQTRGLFHKAIMQSGCALSEWV--ESPDNNWAFRLAQNLGYKGDEKDADVLSFLS 284

  Rat   280 ITDPRALTLAYRLPLKSQEYPIVHYLAFIPVV-----DGDFIPDDPINLYDNA--ADIDYLAGIN 337
            ....|.:....:..:...|.......||.||:     |...:|....:|...|  .||..:.|.|
  Fly   285 KVCARQIAAIDQDVINLDEVRSFLLFAFGPVIEPYETDHCVVPKRHKDLLSEAWGNDIPVIVGGN 349

  Rat   338 DMDGHLFATVDVPAIDKAKQDVTEEDFYRLVSGHTV-------AKGLKGTQATFDIYTESWAQDP 395
            ..:| ||:           ..:..:|.:.|.:.|.:       ...|:|.    |:......|..
  Fly   350 SFEG-LFS-----------YQLVRKDPWALKNFHNILPREVRETSSLEGQ----DLLVRRLKQLY 398

  Rat   396 SQENMKKTVVAFETDILF-----LIPTEMALAQHRAHAKSAKTYSYLFSHPS-------RMPIYP 448
            ....|::::..||...:|     ...|...:...:::|....||.|.|...|       |:....
  Fly   399 FNNEMQESMEMFEALNIFSHRQIWHDTHRFILARQSYAPKTPTYLYRFDFDSPHFNQFRRLVCGD 463

  Rat   449 KWMGADHADDLQYVFGKPFATPLGYRAQDRTVSKAMIAYWTNFAKSGDPN 498
            :..|..|||:|.|:|....|:.|...:.:....:.|:..||:||.||:||
  Fly   464 RIRGVAHADELSYLFYNIIASKLDKSSMEYKTIERMVGMWTSFASSGNPN 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CelNP_058693.2 COesterase 26..542 CDD:278561 152/505 (30%)
Aes <118..>247 CDD:223730 62/130 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..612
4 X 11 AA tandem repeats, O-glycosylated region 556..599
alpha-Est2NP_001262345.1 COesterase 32..523 CDD:278561 152/505 (30%)
Aes <117..>221 CDD:223730 48/112 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336390
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.640

Return to query results.
Submit another query.