DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cel and CG4382

DIOPT Version :9

Sequence 1:NP_058693.2 Gene:Cel / 24254 RGDID:2331 Length:612 Species:Rattus norvegicus
Sequence 2:NP_609301.2 Gene:CG4382 / 34279 FlyBaseID:FBgn0032132 Length:580 Species:Drosophila melanogaster


Alignment Length:587 Identity:176/587 - (29%)
Similarity:264/587 - (44%) Gaps:124/587 - (21%)


- Green bases have known domain annotations that are detailed below.


  Rat    35 GVNKKLSLL-----------------GGDSVDIFKGIPFATAKT----LENPQRHPGWQGTLKAT 78
            |.||:||.|                 .|.:...|:|||:|....    .:.|:....|..||.||
  Fly    36 GSNKELSDLVITTALGKIRGTILPSQSGRNFYAFRGIPYAKPPVDRLRFQPPEPVEQWFDTLDAT 100

  Rat    79 DFKKRCLQATITQDDTYGQEDCLYLNIWVPQ--GRKQVSHDLPVMVWIYGGAFLMGSGQGANFLK 141
            ....:|.|..:...|.  .||||.:||:..:  ...|.:...||:|:|:.|.|...|||..||. 
  Fly   101 FDGPKCPQLGLVSGDV--SEDCLRVNIYTKELPSESQPNVRRPVIVFIHPGGFYSLSGQSKNFA- 162

  Rat   142 NYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNFGLRDQHMAIAWVKRNIAAFGGDPD 206
                 |.:......:::||||||:|.||||:||....|||.||:||...:.|||.:|:.|||||.
  Fly   163 -----GPQYFMNRRLVLVTFNYRLGSLGFLATGTREAPGNMGLKDQVQLLRWVKLHISRFGGDPS 222

  Rat   207 NITIFGESAGAASVSLQTLSPYNKGLIRRAISQSGVALSPWAIQENPLFWAKTIAKKVGCPTEDT 271
            :||:.|..|||.:|:|..:||.::||..:||..||.....|::.::.:..|...|..:.|.||:.
  Fly   223 SITLLGYGAGAMAVTLHMVSPMSRGLFHKAIVMSGAVTGQWSLPDHQMDVATKQATLLHCHTENV 287

  Rat   272 AKMAGCLKITDPRALTLAYRLPLKSQEY----PIVHYLAFIPVVDGD-----FIPDDPINLYDNA 327
            .:|..|||  ....|..|..|| |..|:    |::   .:.||::.|     |:.::||..|.|.
  Fly   288 TEMMDCLK--GKHYLEFANTLP-KMFEFDRNNPLI---LWKPVIEPDFGQERFLVEEPIRSYQND 346

  Rat   328 ADIDYLAGINDMDGHLFATVDVPAIDKAKQDVTEEDF----YRLVSGHTVAKGL----KGTQATF 384
               |::              .||.|    ..:|:::|    ..::...|:...|    :.....|
  Fly   347 ---DFM--------------KVPII----TGMTKDEFVGPALSILQSPTLLSALNENFESLAPVF 390

  Rat   385 DIYTESWAQ--DPSQE-----------NMKKTVVAFE---TDIL--FLIPTEMALAQHRAHAKSA 431
            .:|..|.|:  :.|||           :..:::.|..   :|.|  |.|...:.||     |:|.
  Fly   391 FMYNTSDARACNISQELRNHYFPDKLIDANRSLEALSNLYSDALTGFGIHRFVHLA-----ARST 450

  Rat   432 KTYSYLFSHP-SRMPIY-----PKWMGADHADDLQYVFGKPFATPLGYRAQD--RTVSKAMIAYW 488
            |.|.|.||:. :|..||     |  .|..|.|||.|:|.:|..:.:.....|  |.|. .|:..:
  Fly   451 KVYYYRFSYQGARSHIYYPEDAP--YGVVHHDDLMYLFVEPSISRMFTEDDDEFRMVD-IMVRMF 512

  Rat   489 TNFAKSGDPNMGNSPVPT-------HWYPYTTENGNYLDINKKITSTSMKEHLREKFLKFWAVTF 546
            :.||..||||.     ||       .|.|::.:...||||.|.||   ::|:|..:..:.|...|
  Fly   513 SAFAYKGDPNK-----PTDLALRDIRWRPFSFKKRYYLDIGKHIT---LEENLNAENYEIWKRLF 569

  Rat   547 EM 548
            .:
  Fly   570 PL 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CelNP_058693.2 COesterase 26..542 CDD:278561 174/579 (30%)
Aes <118..>247 CDD:223730 57/128 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..612
4 X 11 AA tandem repeats, O-glycosylated region 556..599
CG4382NP_609301.2 COesterase 41..565 CDD:278561 171/574 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336399
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.