DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cd53 and Tsp74F

DIOPT Version :9

Sequence 1:NP_036655.1 Gene:Cd53 / 24251 RGDID:2310 Length:219 Species:Rattus norvegicus
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:232 Identity:71/232 - (30%)
Similarity:118/232 - (50%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MGMSSL-----KLLKYVLFFFNFLFWVCGCCILGFGIHLLVQNTY--GILFRNLPFLTLGNVLVI 58
            ||.||.     :.:||.||..||:.:|.|..:....:..||..::  .:|..|| |.....||::
  Fly     1 MGFSSRMDCCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNL-FSGAVYVLLV 64

  Rat    59 VGSIIMVVAFLGCMGSIKENKCLLMSFFVLLLLILLAEVTLAILLFVYEKKINTLVAEGLNDSIQ 123
            ...||.:|:||||:|:.||.||||:::|:::.|:.:..:...:|.:|:.:::...:.:.:..::.
  Fly    65 TSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMA 129

  Rat   124 HYHSDNSTRMAWDFIQSQLQCCGVNGSSDWIS-GP-PSSCPS---GADVQGC---------YKKG 174
            .|.|......|||..|.:||||||:...||.. || |.||..   |...:.|         |.:|
  Fly   130 LYGSRREITQAWDLTQERLQCCGVDTWHDWNRYGPVPESCCQELFGGQRKECTIFPTITNLYNQG 194

  Rat   175 QAWFHSNFL-----YIGIVTICVCVIQVLGMSFALTL 206
            ..:..:||:     .||..:|.|.::.:.||.|:..|
  Fly   195 CLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cd53NP_036655.1 Tetraspannin 9..210 CDD:278750 67/219 (31%)
CD53_like_LEL 104..186 CDD:239417 26/100 (26%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 66/217 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X124
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.