DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cd53 and Tsp39D

DIOPT Version :9

Sequence 1:NP_036655.1 Gene:Cd53 / 24251 RGDID:2310 Length:219 Species:Rattus norvegicus
Sequence 2:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster


Alignment Length:226 Identity:72/226 - (31%)
Similarity:114/226 - (50%) Gaps:22/226 - (9%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MGMSSLKLLKYVLFFFNFLFWVCGCCILGFGIHLLVQNTYGIL--FRNLPFLTLGNVLVIVGSII 63
            |....|..:||:.||.|.||.:.|  :|.|.:..:||..|...  |.:....|...:|:|||:.:
  Fly     1 MASGGLTCVKYLTFFCNLLFALTG--LLIFLVGGMVQLNYAHYSNFVSDHVWTAPIILMIVGAAV 63

  Rat    64 MVVAFLGCMGSIKENKCLLMSFFVLLLLILLAEVTLAILLFVYEKKINTLVAEGLNDSIQHYHSD 128
            .|:.||||.|::||:.|:::||.:|.::|.|.|:.|.:..:|....::.::....|.::|||...
  Fly    64 AVICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKER 128

  Rat   129 NSTRMAWDFIQSQLQCCGVNGSSDW-----ISGPPSSCPS-------------GADVQGCYKKGQ 175
            ...|.||..:|::|.|||:||.:||     .|..|::|.|             .|...||.:|..
  Fly   129 ADYRDAWTLLQTELDCCGINGPNDWETVYRNSTLPAACCSVINLSEAKECTNTHATQHGCLQKLL 193

  Rat   176 AWFHSNFLYIGIVTICVCVIQVLGMSFALTL 206
            ....|..|.:..|.:.|..||:|.:.||..|
  Fly   194 EILDSKTLILASVVLGVAGIQMLTILFACCL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cd53NP_036655.1 Tetraspannin 9..210 CDD:278750 70/218 (32%)
CD53_like_LEL 104..186 CDD:239417 27/99 (27%)
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 70/219 (32%)
tetraspanin_LEL 104..200 CDD:239401 26/95 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.