DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cd53 and Tsp29Fa

DIOPT Version :9

Sequence 1:NP_036655.1 Gene:Cd53 / 24251 RGDID:2310 Length:219 Species:Rattus norvegicus
Sequence 2:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster


Alignment Length:232 Identity:68/232 - (29%)
Similarity:112/232 - (48%) Gaps:30/232 - (12%)


- Green bases have known domain annotations that are detailed below.


  Rat     5 SLKLLKYVLFFFNFLFWVCGCCILGFGIHLLVQNTYGILFRNLPFLTLGNVLVIVGSIIMVVAFL 69
            |...:||.||.||.:|.:.|..::..|..:....|...||....|.::...|:::||.|::::|.
  Fly     7 SANAVKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAGKFFSIPTFLIVIGSFIIIISFF 71

  Rat    70 GCMGSIKENKCLLMSFFVLLLLILLAEVTLAILLFVYEKKINTLVAEGLNDSIQHYHS--DNSTR 132
            ||.|::|||.||::||.|:|.:|.:.|:...|..:|.....:.|:...|..|:..|:|  .|:|.
  Fly    72 GCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLNEYNSINPNATT 136

  Rat   133 MAWDFIQSQLQCCGVNGSSDWISGPPS-----SC-----------------PSGADVQ--GCYKK 173
            ..||.||.:.:||||...:|||:..|:     ||                 .|.||..  ||...
  Fly   137 KLWDDIQDEFECCGVTSYNDWITAFPNGDLPISCCNVHVGAVGTFTCNNAQSSVADRHKVGCLDG 201

  Rat   174 GQAWFHSNFLYIGIVTICVCVIQVLGMSFALTLNCQI 210
            ...:..::.:.:|...:.:.::|..|:.||    |.|
  Fly   202 FSGYISAHAVSLGAAGVVIAILQFFGVIFA----CYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cd53NP_036655.1 Tetraspannin 9..210 CDD:278750 66/226 (29%)
CD53_like_LEL 104..186 CDD:239417 27/107 (25%)
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 67/228 (29%)
tetraspanin_LEL 106..210 CDD:239401 27/103 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.