DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cd53 and Tsp5D

DIOPT Version :9

Sequence 1:NP_036655.1 Gene:Cd53 / 24251 RGDID:2310 Length:219 Species:Rattus norvegicus
Sequence 2:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster


Alignment Length:256 Identity:62/256 - (24%)
Similarity:110/256 - (42%) Gaps:46/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Rat     1 MGMSSLKLLKYVLFFFNFLFWVCGCCILGFGIHL-LVQNTYGILFRNLPFLTLGNVLVIVGSIIM 64
            ||.:....::....:.|.:.|:|.|..||.|:.| |....|..|......|:...:.:.:|....
  Fly     1 MGNAGYTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGF 65

  Rat    65 VVAFLGCMGSIKENKCLLMSFFVLLLLILLAEVTLAILLFVYEKKINTLVAEGLNDSIQ-HYHSD 128
            ||:|.||.|:..:::|||:.:|:|::::.::|..:..:.|::...:...:|..|...|: ||:|.
  Fly    66 VVSFFGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSS 130

  Rat   129 N-------STRMAWDFIQSQLQCCGVNGSSDWI---SGP-----PSSC----------------- 161
            :       |....||.:|...:||||:...||.   |.|     |.||                 
  Fly   131 DRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGD 195

  Rat   162 ------------PSGADVQGCYKKGQAWFHSNFLYIGIVTICVCVIQVLGMSFALTLNCQI 210
                        ||....:||....|:||......:|.|.:.:..:|:.|:..::.|.|.:
  Fly   196 GMMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cd53NP_036655.1 Tetraspannin 9..210 CDD:278750 60/246 (24%)
CD53_like_LEL 104..186 CDD:239417 29/126 (23%)
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 60/247 (24%)
NET-5_like_LEL 105..228 CDD:239418 29/122 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4711
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4397
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1224210at2759
OrthoFinder 1 1.000 - - FOG0001172
OrthoInspector 1 1.000 - - otm45499
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X124
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.