DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Calm3 and Eip63F-1

DIOPT Version :9

Sequence 1:NP_036650.1 Gene:Calm3 / 24244 RGDID:2259 Length:149 Species:Rattus norvegicus
Sequence 2:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster


Alignment Length:160 Identity:57/160 - (35%)
Similarity:95/160 - (59%) Gaps:19/160 - (11%)


- Green bases have known domain annotations that are detailed below.


  Rat     6 TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 70
            ||.:|.:.:.||.|.|::.||.:|..||..::::||.|.::..:.|:|.|....|||.|:..|||
  Fly    33 TEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFL 97

  Rat    71 TMMAR------------KMKDT-------DSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEK 116
            ..:.|            ..||:       |..|::..||||||:||||:|:..||:..|..:||.
  Fly    98 QWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIGEP 162

  Rat   117 LTDEEVDEMIREADIDGDGQVNYEEFVQMM 146
            |.::::::::..||:|.||::|||||.:::
  Fly   163 LNEQQLEQLLVIADLDQDGRINYEEFTRLL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Calm3NP_036650.1 PTZ00184 1..149 CDD:185504 57/160 (36%)
Necessary and sufficient for interaction with PCP4. /evidence=ECO:0000250|UniProtKB:P0DP25 77..149 31/77 (40%)
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 57/160 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.