DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atp4b and CG33310

DIOPT Version :9

Sequence 1:NP_036642.2 Gene:Atp4b / 24217 RGDID:2178 Length:294 Species:Rattus norvegicus
Sequence 2:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster


Alignment Length:347 Identity:60/347 - (17%)
Similarity:116/347 - (33%) Gaps:131/347 - (37%)


- Green bases have known domain annotations that are detailed below.


  Rat     8 KSCSQRM---AEFRQYCWNPDTGQMLGRTPARWVWISLYYAAFYVVMTGLFALCIYVLMQTIDPY 69
            |.|....   .|:|:..:|...|:...|.|:.|:: :|.::..|::...:|::..:         
  Fly   572 KGCEYHFPGRTEWRRLFFNKIHGKYKLRRPSHWLY-TLVFSVLYILFVIIFSMAWF--------- 626

  Rat    70 TPDYQDQLKSPGVTLRPDVYGERGLQISYNISENSSWAGLTHTLHSFLAGYTPASQQDSINCSSE 134
                 |.:|                      .:.|....:......|:: :||...:.:      
  Fly   627 -----DFIK----------------------DDASRKVPMIKMAQPFIS-FTPIGPRTN------ 657

  Rat   135 KYFFQETFSAPNHTKFSCKFTADMLQNCSGLV--------------------DPSFGFEEGKPCF 179
                      |....|..:.:.::::..:|::                    :..||:..|:||.
  Fly   658 ----------PKAVSFDPRNSTEVMEKYAGIMALLEKYGDYGHNPRFGTCTANEKFGYPSGEPCV 712

  Rat   180 IIKMNRIVKF--------------------------LPSNNTAP-----RVDCTFQDDPQKPRKD 213
            .:|:|||:.|                          |..|.|..     |...|.:.|..|    
  Fly   713 FLKVNRIIGFKTEPYINSDELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDK---- 773

  Rat   214 IEPLQVQYYPPNGTFS--------LHYFPYYGKKA--QPHYSNPLVAAKFLNVPKNTQVLIVCKI 268
              .:.::::|.....:        :.|....|||:  .|:..|.:||.|..|:..|.:|.|.||:
  Fly   774 --NVLIEFHPEPAIRTEYTDIEEKIEYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKM 836

  Rat   269 MADHVTFDNPHDPYE--GKVEF 288
            .|.::     |...|  |:|.|
  Fly   837 WAQNI-----HHRKEGYGQVSF 853

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atp4bNP_036642.2 Na_K_ATPase_bet 2..294 CDD:273446 60/347 (17%)
immunoglobulin-like. /evidence=ECO:0000250 194..294 27/112 (24%)
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 35/154 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.