DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ascl2 and Fer1

DIOPT Version :9

Sequence 1:NP_113691.1 Gene:Ascl2 / 24209 RGDID:2159 Length:260 Species:Rattus norvegicus
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:87 Identity:31/87 - (35%)
Similarity:45/87 - (51%) Gaps:10/87 - (11%)


- Green bases have known domain annotations that are detailed below.


  Rat    88 CTARRRPPSPELLRCSRRRRSGATEASSSSAAVARRNERERNRVKLVNLGFQALRQHVPHGGANK 152
            |...||...|..|:|:.:.      |....||    |.|||.|::.:|..|:.||.|:|.....|
  Fly    66 CPFSRRSHKPRRLKCASQM------AQQRQAA----NLRERRRMQSINEAFEGLRTHIPTLPYEK 120

  Rat   153 KLSKVETLRSAVEYIRALQRLL 174
            :||||:||:.|:.||..|..::
  Fly   121 RLSKVDTLKLAISYITFLSEMV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ascl2NP_113691.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..126 10/37 (27%)
HLH 134..176 CDD:197674 17/41 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..239
Fer1NP_001262334.1 HLH 92..144 CDD:197674 22/51 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.