DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ascl2 and Fer1

DIOPT Version :10

Sequence 1:NP_113691.1 Gene:Ascl2 / 24209 RGDID:2159 Length:260 Species:Rattus norvegicus
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:87 Identity:31/87 - (35%)
Similarity:45/87 - (51%) Gaps:10/87 - (11%)


- Green bases have known domain annotations that are detailed below.


  Rat    88 CTARRRPPSPELLRCSRRRRSGATEASSSSAAVARRNERERNRVKLVNLGFQALRQHVPHGGANK 152
            |...||...|..|:|:.:.      |....||    |.|||.|::.:|..|:.||.|:|.....|
  Fly    66 CPFSRRSHKPRRLKCASQM------AQQRQAA----NLRERRRMQSINEAFEGLRTHIPTLPYEK 120

  Rat   153 KLSKVETLRSAVEYIRALQRLL 174
            :||||:||:.|:.||..|..::
  Fly   121 RLSKVDTLKLAISYITFLSEMV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ascl2NP_113691.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..126 10/37 (27%)
bHLH_TS_ASCL2_Mash2 128..180 CDD:381586 19/47 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..239
Fer1NP_001262334.1 bHLH_TS_PTF1A 87..142 CDD:381423 24/58 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.