DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Akr1b1 and CG2767

DIOPT Version :9

Sequence 1:NP_036630.1 Gene:Akr1b1 / 24192 RGDID:2092 Length:316 Species:Rattus norvegicus
Sequence 2:NP_649757.1 Gene:CG2767 / 40946 FlyBaseID:FBgn0037537 Length:329 Species:Drosophila melanogaster


Alignment Length:321 Identity:139/321 - (43%)
Similarity:194/321 - (60%) Gaps:17/321 - (5%)


- Green bases have known domain annotations that are detailed below.


  Rat     5 LELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQEKLKEQVVK 69
            |..|||.|||.:|:|||::...::..|:..|::.||||||.|.||.|||.:|..|:..|....||
  Fly     7 LTFNNGEKMPVIGIGTWQASDEEIETAIDAALEAGYRHIDTAPVYGNEKAIGRVLKRWLDAGKVK 71

  Rat    70 RQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGPD-YFPLDASGNV-I 132
            |::||||:|:....:....|:...:|:|.||||||:||||:|.|.......| .|.||..|.: :
  Fly    72 REELFIVTKVPPVSNRPHEVEPTIKKSLEDLQLDYVDLYLVHTPFTININEDGSFKLDKEGLMEV 136

  Rat   133 PSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKPAVNQIECHPYLTQEKLI 197
            ...|:....|.|||.||::||.|:||||||:..|:.|:|.  ..|.:||.||||.|.||.|..|:
  Fly   137 DVTTNHAAIWVAMEALVEKGLTKSIGVSNFSKDQVARLLK--NCKIRPANNQIEHHVYLQQRDLV 199

  Rat   198 EYCHCKGIVVTAYSPLGSPDRPWAK--------PEDPSLLEDPRIKEIAAKYNKTTAQVLIRFPI 254
            ::|..:.|.|||||||||  :..||        .:.|.|::.|.:|||||.:.||.||||:|:.|
  Fly   200 DFCKSENITVTAYSPLGS--KGIAKFNAGAGIVRDLPDLMDIPEVKEIAASHGKTPAQVLLRWII 262

  Rat   255 QRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCALM---SCAKHKDYPF 312
            ...:..||||..|||:.:|..||||||:.|::|.|.|.::|.|:|...   ...:|.::.|
  Fly   263 DTGVSAIPKSTNPARLKQNLDVFDFELTAEEVAKLSSLDQNIRICDFAFFHGVERHPEFTF 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Akr1b1NP_036630.1 ARA1 1..297 CDD:223729 135/301 (45%)
Tas 8..289 CDD:223739 131/290 (45%)
CG2767NP_649757.1 ARA1 5..302 CDD:223729 134/298 (45%)
Tas 10..297 CDD:223739 131/290 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53635
OrthoDB 1 1.010 - - D1016440at2759
OrthoFinder 1 1.000 - - FOG0000042
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X51
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.