DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ada and Adgf-E

DIOPT Version :9

Sequence 1:NP_569083.1 Gene:Ada / 24165 RGDID:2031 Length:352 Species:Rattus norvegicus
Sequence 2:NP_610977.1 Gene:Adgf-E / 36627 FlyBaseID:FBgn0033952 Length:539 Species:Drosophila melanogaster


Alignment Length:335 Identity:85/335 - (25%)
Similarity:139/335 - (41%) Gaps:71/335 - (21%)


- Green bases have known domain annotations that are detailed below.


  Rat    47 RNIIGMDKPLSLPDFLAKF-----DYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVR-YSPH 105
            |:::|:   ..|.|.|.::     |||..|:.           ||.    .:||.|:||| ..|.
  Fly   226 RHMMGI---FGLLDGLLQYAPVWGDYYYNALK-----------EFY----ADGVQYLEVRSVLPQ 272

  Rat   106 LLANSKVDPIPWNQAEGDLTPD-EVVDLVNQGLQ--EGEQAFGIKVRSILCCMRH-QPSWSPEVL 166
            |.:           .:|...|. |.|.:....|:  :.|....|..:.|...:|| ||....|.:
  Fly   273 LYS-----------LDGSRMPKRETVQIYKDTLERFKKEHPGFIDSKLIYAPIRHVQPELVGEYI 326

  Rat   167 ELCKKYHQK---TVVAMDLAGDETIEGSSLFPGHVEAYEGA----VKDGIHRTVHAGEVG--SAE 222
            :.|.:.:::   .||..||.|.|.:       ||..:...|    :.|.||...|||:..  .:.
  Fly   327 KECTELNKEFPSFVVGFDLVGQEDV-------GHPLSNFAAELLKLPDHIHFYFHAGQTNWYGSH 384

  Rat   223 VVREAVD--ILKTERVGHGYHTIEDEALYNRLLKE-NMHFEVCPWSSYLTGAWNPKTTHAVVRFK 284
            |.:..:|  :|.|:|:|||| ||....:..||.|. |:..||||.|:.:....:...:|......
  Fly   385 VDQNLLDAIVLGTKRIGHGY-TITKHPVLMRLAKYLNIALEVCPVSNQVLQLGSDYRSHPAATLI 448

  Rat   285 DDQANYSLNSDDPLIFKST-VDTDYQM-------VKKDMGFTEEEFKRLNINAAKSSFLPEDEKK 341
            .:.....:.|..|..:::. :..|:.|       :..|:.|    .||...|:.|.|.|.::.|.
  Fly   449 AENVPMVIASGSPGFWRAAPLSHDFYMAFLGIAPMNADLKF----LKRTAKNSIKYSSLKDEAKA 509

  Rat   342 ELLERLYKEY 351
            |.:|:..|::
  Fly   510 EAMEKWKKQW 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdaNP_569083.1 metallo-dependent_hydrolases 9..347 CDD:294200 84/329 (26%)
Adgf-ENP_610977.1 A_deaminase_N 46..125 CDD:285627
adm_rel 52..527 CDD:273620 85/335 (25%)
ADGF 105..519 CDD:238646 85/333 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.