DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pin1rt1 and CG32845

DIOPT Version :9

Sequence 1:NP_001028940.1 Gene:Pin1rt1 / 241593 MGIID:3649546 Length:159 Species:Mus musculus
Sequence 2:NP_728511.1 Gene:CG32845 / 318243 FlyBaseID:FBgn0052845 Length:386 Species:Drosophila melanogaster


Alignment Length:165 Identity:61/165 - (36%)
Similarity:90/165 - (54%) Gaps:11/165 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 KLPPGWKKYMSRSSGREYYFNHITNASQWERP---SEGSSKNGQGE--------PARVRCSHLLV 58
            |||.||::.::.|:...|:::.||....:..|   .....:|..|.        ..::||.|:||
  Fly    72 KLPFGWEERIAHSTKECYFYDTITRKVHFTLPPSHHREKDRNAWGAILGDYSDFNDQLRCRHILV 136

Mouse    59 KHSQSRRPSSWRQEKITRSKEEALELINGYIRKIKSGEEDFESLASQFSDCSSAKARGDLGAFSR 123
            |||:|.|.||:|:..:.|:|:|||..|......|:||:.:|..||:..|||.||:..||||..|.
  Fly   137 KHSESDRCSSYRERMVRRTKQEALNKIMHARDLIQSGKFEFAELANMISDCCSARHGGDLGPLSL 201

Mouse   124 GQMEKPFEDASFALRTGEMSGPVFTESGIHIILRT 158
            .|....||.....|:.||:|....|::|.||:|||
  Fly   202 TQTPFVFERNILLLKDGELSEIFQTKAGYHILLRT 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pin1rt1NP_001028940.1 WW 6..36 CDD:366073 8/29 (28%)
Rotamase_2 47..158 CDD:391994 47/118 (40%)
CG32845NP_728511.1 WW 73..103 CDD:278809 8/29 (28%)
Rotamase_2 127..237 CDD:298667 49/110 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849225
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0760
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001686
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10657
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.