DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf10 and Taf10b

DIOPT Version :9

Sequence 1:NP_064408.2 Gene:Taf10 / 24075 MGIID:1346320 Length:218 Species:Mus musculus
Sequence 2:NP_477418.1 Gene:Taf10b / 33468 FlyBaseID:FBgn0026324 Length:146 Species:Drosophila melanogaster


Alignment Length:139 Identity:75/139 - (53%)
Similarity:94/139 - (67%) Gaps:10/139 - (7%)


- Green bases have known domain annotations that are detailed below.


Mouse    81 AAGGAAPPEGAMSNGVYALPSAANGEVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFE 145
            :||||: ..|..|.|      ...|:......|:.|.||:.|||||||.||||||.:|||..||:
  Fly    13 SAGGAS-SHGQSSGG------GGGGDRDRTTPSSHLSDFMSQLEDYTPLIPDAVTSHYLNMGGFQ 70

Mouse   146 ASDPRIIRLISLAAQKFISDIANDALQHCKMK---GTASGSSRSKSKDRKYTLTMEDLTPALSEY 207
            :.|.||:|||||||||::|||.:|||||.|.:   .|.:....||:||||:|||||||.|||::|
  Fly    71 SDDKRIVRLISLAAQKYMSDIIDDALQHSKARTHMQTTNTPGGSKAKDRKFTLTMEDLQPALADY 135

Mouse   208 GINVKKPHY 216
            ||||:|..|
  Fly   136 GINVRKVDY 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf10NP_064408.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..86 3/4 (75%)
TAF10 115..217 CDD:187739 66/105 (63%)
[KR]-[STA]-K motif 187..189 1/1 (100%)
Taf10bNP_477418.1 TAF10 41..144 CDD:187739 65/102 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832358
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5162
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4543
Isobase 1 0.950 - 0 Normalized mean entropy S1185
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004416
OrthoInspector 1 1.000 - - oto92794
orthoMCL 1 0.900 - - OOG6_103784
Panther 1 1.100 - - LDO PTHR21242
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2306
SonicParanoid 1 1.000 - - X3131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.730

Return to query results.
Submit another query.