DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgcb and Scgdelta

DIOPT Version :9

Sequence 1:NP_036020.1 Gene:Sgcb / 24051 MGIID:1346523 Length:320 Species:Mus musculus
Sequence 2:NP_001162639.2 Gene:Scgdelta / 31129 FlyBaseID:FBgn0025391 Length:404 Species:Drosophila melanogaster


Alignment Length:343 Identity:73/343 - (21%)
Similarity:135/343 - (39%) Gaps:92/343 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 AAAAAATEQQG-SNGPV-----KKSMREKAVERRNVNKEHNSNFKAGYIPIDEDRLHKTGLRGRK 63
            |....||...| |:|..     .:|.|..|..|.||:         |::...|..|   ||.|.:
  Fly    88 ATTGKATVSHGHSHGHALGRSETRSGRSAAAGRSNVD---------GFVGGIETYL---GLIGWR 140

Mouse    64 GNLAICVIVLLFILAVINLLITLVIWAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHPLYK-S 127
            ......:::||.:|.:.||::||.|..|:.....|...::....|:    |:|...:|..:.: |
  Fly   141 KKCLYTLLLLLMLLIITNLVLTLWILKVMEFSTEGMGQLKIVPGGI----QLSGQAIIMDMLRAS 201

Mouse   128 TVGGR----------RN------------ENLVITGNNQPIVFQ-----------QGTTKLSVEK 159
            |:..|          ||            ||.:..|:::   |:           .|.:..||.:
  Fly   202 TIRSRHGQPISIESSRNFSINTRDPNGMIENHLFLGHDK---FECLSAGFRINDTNGRSLFSVNR 263

Mouse   160 NKTSITSDIGMQFFDPRTHNI--------LFSTDYETHEFHLPSGVKSLNVQKASTERITSNATS 216
            ::.:|.:           |.:        :|....:|.......| :.|.:: :.|.::...|..
  Fly   264 DEVTIGA-----------HALRIDGEGGAVFRESVQTPHVRAEPG-RELRLE-SPTRQLEMTAAK 315

Mouse   217 DLNIKVDGRAIVRGNEGVFIMGKTIEFH-MGGDVELKAENSIILNGTVMVSPTRLPSSSSGDQSG 280
            |:|::  .||  .|.|.|.:  :.::|. :.|.:.|:: :.|::.......|..|.::.|.|...
  Fly   316 DINLQ--SRA--GGIEVVAL--EDVKFRALDGSLRLES-SKILMPNLRTAQPPILGTAQSRDHMH 373

Mouse   281 SGDWVRYKLCMCADGTLF 298
            .    .::||.|::|.||
  Fly   374 R----VFQLCACSNGKLF 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SgcbNP_036020.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 10/34 (29%)
Sarcoglycan_1 61..302 CDD:282624 56/281 (20%)
ScgdeltaNP_001162639.2 Sarcoglycan_1 160..393 CDD:282624 50/259 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.